Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession B5MD39 A6NEA2
Symbols GGT

Gene

PANTHER Protein Class (2)

AA Sequence

MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSG      1 - 70
ILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALA     71 - 140
IIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGW    141 - 210
AAASDSRKGGEPAGY                                                           211 - 225
//

Text Mined References (5)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18357469 2008 The human gamma-glutamyltransferase gene family.
10591208 1999 The DNA sequence of human chromosome 22.
7906515 1994 Expression of multiple gamma-glutamyltransferase genes in man.
2904146 1988 Cloning and nucleotide sequence of human gamma-glutamyl transpeptidase.