Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession B4DZS4
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MPKTEETVLQNDPSVAENGAPEPKTPGQSQKSKSFCLDDQSPDLIETVNEVSKLSISHEIVVNQDFYVEE      1 - 70
TILPPNSVEGRFAEAMYNAFWNHLKEQLLSTPPDFTCALELLKDVKETLLSLLLPWQNRLRNEIEEALDT     71 - 140
DLLKQEAEHGALDVPHLSNYILNLMALLCAPVRDEAIQKLETIRDPVQLLRGILRVLGLMKMDMVNYTIQ    141 - 210
SFRPYLQEHSIQYEQAKFQELLDKQPSLLDYTTKWLTKAATDITTLCPSSPDSPSSSCSMACSLPSGADS    211 - 280
ADGQNPAPGTGIPVAPVNCPGLSLASGQKLLW                                          281 - 312
//

Text Mined References (2)

PMID Year Title