Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.19
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession B2RXF5 B7ZW21
Symbols LCCS6
ZNF925

Gene

Gene RIF (4)

PMID Text
25055871 ZBTB42 mutation defines a novel lethal congenital contracture syndrome.
21193930 Data show that ZBTB42 protein is expressed in human skeletal muscle and a murine cell line C2C12 myotubes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDI      1 - 70
VTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPP     71 - 140
CPWPVWTADLCPAARKAKLPPFGVKAALPPRASGPPPCQVPEESDQALDLSLKSGPRQERVHPPCVLQTP    141 - 210
LCSQRQPGAQPLVKDERDSLSEQEESSSSRSPHSPPKPPPVPAAKGLVVGLQPLPLSGEGSRELELGAGR    211 - 280
LASEDELGPGGPLCICPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPDGVAPTCPLCGKTFSCTYTLK    281 - 350
RHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVHTREKPHACRWCERRFTQSGDLYRHVRKFHCGLVKSL    351 - 420
LV                                                                        421 - 422
//

Text Mined References (8)

PMID Year Title
25055871 2014 ZBTB42 mutation defines a novel lethal congenital contracture syndrome (LCCS6).
24097068 2013 Discovery and refinement of loci associated with lipid levels.
21193930 2011 Characterization of the ZBTB42 gene in humans and mice.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.