Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.19
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDI      1 - 70
VTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPP     71 - 140
CPWPVWTADLCPAARKAKLPPFGVKAALPPRASGPPPCQVPEESDQALDLSLKSGPRQERVHPPCVLQTP    141 - 210
LCSQRQPGAQPLVKDERDSLSEQEESSSSRSPHSPPKPPPVPAAKGLVVGLQPLPLSGEGSRELELGAGR    211 - 280
LASEDELGPGGPLCICPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPDGVAPTCPLCGKTFSCTYTLK    281 - 350
RHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVHTREKPHACRWCERRFTQSGDLYRHVRKFHCGLVKSL    351 - 420
LV                                                                        421 - 422
//

Text Mined References (8)

PMID Year Title