Property Summary

NCBI Gene PubMed Count 10
PubMed Score 226.78
PubTator Score 28.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.2e-11
Disease Target Count Z-score Confidence
Aortic valve stenosis 28 3.2 1.6
Hereditary elliptocytosis 22 3.074 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 1.2e-11

Gene RIF (7)

AA Sequence

MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLT      1 - 70
GYYVHKCK                                                                   71 - 78
//

Text Mined References (14)

PMID Year Title