Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
R01 Count 2
Funding $161,314.67
PubMed Score 15.44
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (3)

PMID Text
24956034 Given that ISM1 has been reported to have anti-angiogenic properties, these observations suggest that ISM1 is a mediator of lymphocyte effector functions and may participate in both innate and acquired immune responses.
23333304 HIV-1 Vif upregulates the expression of isthmin 1, angiogenesis inhibitor (ISM1) in Vif-expression T cells
21544092 Isthmin unexpectedly has both a pro-survival and death-promoting effect on endothelial cells depending on its physical state.

AA Sequence

MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPRE      1 - 70
HLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEAD     71 - 140
KDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKD    141 - 210
QPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAG    211 - 280
SEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKD    281 - 350
ASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV    351 - 420
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY                              421 - 464
//

Text Mined References (11)

PMID Year Title
25952901 2015 Isthmin is a novel vascular permeability inducer that functions through cell-surface GRP78-mediated Src activation.
24956034 2014 Isthmin 1 is a secreted protein expressed in skin, mucosal tissues, and NK, NKT, and th17 cells.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
21544092 2011 Isthmin exerts pro-survival and death-promoting effect on endothelial cells through alphavbeta5 integrin depending on its physical state.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19874420 2011 Isthmin is a novel secreted angiogenesis inhibitor that inhibits tumour growth in mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12128218 2002 Isthmin is a novel secreted protein expressed as part of the Fgf-8 synexpression group in the Xenopus midbrain-hindbrain organizer.
More...