Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.47
PubTator Score 12.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis -1.400 2.4e-03
Breast cancer -4.000 2.1e-35
breast carcinoma -1.500 2.3e-05
ductal carcinoma in situ -1.300 1.3e-02
intraductal papillary-mucinous adenoma (... -2.000 4.1e-03
intraductal papillary-mucinous carcinoma... -1.700 1.1e-02
invasive ductal carcinoma -2.300 2.9e-03
medulloblastoma, large-cell -1.100 5.4e-05
ovarian cancer 3.400 3.2e-03
pancreatic cancer 1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 1.448 1.0e-02
psoriasis -1.100 1.8e-15

Gene RIF (3)

AA Sequence

MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPRE      1 - 70
HLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEAD     71 - 140
KDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKD    141 - 210
QPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAG    211 - 280
SEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKD    281 - 350
ASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV    351 - 420
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY                              421 - 464
//

Text Mined References (11)

PMID Year Title