Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession B1AK76
Symbols CXorf19

Gene

 Compartment GO Term (0)

AA Sequence

MEQARDHLHLRWTTEQHMPEVEVQVKYRTAALSNQECQLYLRHSQQQQVLVVDFQAKLRQVFITETPRCG      1 - 70
KKPYWNNEEAESKQNPGSIYCLLLLIRGGMSDSLIKREISNFEIVSKNKKN                        71 - 121
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.