Property Summary

NCBI Gene PubMed Count 19
PubMed Score 94.47
PubTator Score 97.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.308 9.8e-05
atypical teratoid / rhabdoid tumor -1.500 3.2e-09
glioblastoma -1.100 4.9e-04
medulloblastoma, large-cell -1.700 2.2e-05
primitive neuroectodermal tumor -1.200 4.1e-03
adult high grade glioma -1.100 1.5e-03
lung adenocarcinoma 1.200 9.1e-08

Gene RIF (6)

PMID Text
26963840 The high expression of AZIN2 in various cells with secretory or vesicle transport activity indicates that the polyamine metabolism regulated by AZIN2
20188728 Both endogenous and FLAG-tagged AZIN2 localize to post-Golgi vesicles of the secretory pathway. Immuno-electron microscopy revealed that the vesicles associate mainly with the trans-Golgi network.
20147969 Observational study of gene-disease association. (HuGE Navigator)
19956990 AZIN2 expression appears to be restricted to brain and testis and it is a labile protein degraded by a ubiquitin-dependent mechanism.
19832840 ODC activity is mostly linked to cell proliferation, whereas its regulation by AZIN2 in post-mitotically differentiated neurons of the brain apparently serves different purposes.
19756694 localization of AZIN2 implies possible involvement in the gonadal synthesis and/or release of steroid hormones.

AA Sequence

MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVK      1 - 70
CNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMEL     71 - 140
AKVVKSHPSAKMVLCIATDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYA    141 - 210
QSIADARLVFEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYY    211 - 280
VTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQP    281 - 350
LYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRR    351 - 420
QLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM                                  421 - 460
//

Text Mined References (19)

PMID Year Title
26963840 2016 Expression of ODC Antizyme Inhibitor 2 (AZIN2) in Human Secretory Cells and Tissues.
25416956 2014 A proteome-scale map of the human interactome network.
24967154 2014 Structural and degradative aspects of ornithine decarboxylase antizyme inhibitor 2.
20217058 2010 Recurrent emergence of catalytically inactive ornithine decarboxylase homologous forms that likely have regulatory function.
20188728 2010 Ornithine decarboxylase antizyme inhibitor 2 regulates intracellular vesicle trafficking.
20147969 2010 Non-synonymous single-nucleotide polymorphisms associated with blood pressure and hypertension.
19956990 2010 Antizyme inhibitor 2: molecular, cellular and physiological aspects.
19832840 2010 Brain neurons express ornithine decarboxylase-activating antizyme inhibitor 2 with accumulation in Alzheimer's disease.
19756694 2009 High expression of antizyme inhibitor 2, an activator of ornithine decarboxylase in steroidogenic cells of human gonads.
19718454 2009 Expression of antizyme inhibitor 2 in mast cells and role of polyamines as selective regulators of serotonin secretion.
17900240 2008 Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14763899 2004 Putrescine biosynthesis in mammalian tissues.
14738999 2004 Expression of human arginine decarboxylase, the biosynthetic enzyme for agmatine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11587527 2001 Expression of a novel human ornithine decarboxylase-like protein in the central nervous system and testes.