Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.24
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 9.1e-04
atypical teratoid / rhabdoid tumor -1.100 7.1e-04
glioblastoma -1.100 1.3e-05
intraductal papillary-mucinous adenoma (... 1.700 1.3e-03
lung cancer 1.300 1.0e-04
oligodendroglioma 1.200 2.6e-02
osteosarcoma 3.185 1.1e-07
ovarian cancer 1.300 2.1e-04
psoriasis 1.200 1.2e-02
Rheumatoid arthritis 1.500 2.6e-03
subependymal giant cell astrocytoma -1.569 7.6e-03

Synonym

Accession Q96GX2
Symbols lnc-SCA7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGAC      1 - 70
RLPLCSLPGEPGNGPDQQLQRSPPEFQ                                                71 - 97
//

Text Mined References (9)

PMID Year Title