Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T6C5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVRERAAAAMAALERRVPSLDDFAGQSWSSWVERADLPAADGAELEESSKNTKKLDAMTLIKEDMSIFG      1 - 70
HCPAHDDFYLVVCNHCSQVVKPQAFQKHCERRHGPLSKLYGRAPPPPPAPASSQKCHVVNGQGPACRAPG     71 - 140
STKTSSREKGQGSRSRGHQPPEKTQKDNLCQPGGLTKDSPGKPPMAPPSKEPPGRENIEIIPSEGSSHWA    141 - 210
EGSPPEKEPSGTRLPPKTHRKMARKECDLNRQCGVINPETKKICTRLLTCKIHSVHQRREVQGRAKDFDV    211 - 280
LVAELKANSRKGESPKEKSPGRKEQVLERPSQELPSSVQVVAAVAAPSSTFSVRAKQTYPYCALPRSRAS    281 - 350
SESELDDEGPCGGDGDPGLFPFPMPRGGTQASSEESEEEGTSDDLHPPPDCHYATRPPRPQAFCTFGSRL    351 - 420
VSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPPAAEPPAHLVNSPLSAPLSPSSTGTCPRLPGPTL    421 - 490
RPACPASMPPTKDNLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGK    491 - 560
DGVEVEAPSRKRKLSPGPTTLKRTCILEPTGKGKPSGCRGLSAKTKTALSMGLNGTMGPRVKRAGPLDCR    561 - 630
GSPHQLPTPVKASQLENRGAAGHPAKALPTNCLSEEEVAKKRKNLATYCRPVKAKHCQAGAPADVACSVR    631 - 700
RKKPGPALAFEEKCSTLKSKAH                                                    701 - 722
//

Text Mined References (6)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125088 2011 Genome-wide association study of recurrent early-onset major depressive disorder.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.