Property Summary

NCBI Gene PubMed Count 51
PubMed Score 40.90
PubTator Score 34.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Seckel syndrome 35
Disease Target Count Z-score Confidence
Fanconi's anemia 50 3.635 1.8
Meier-Gorlin syndrome 12 3.56 1.8

Expression

Gene RIF (19)

PMID Text
24990965 ATRIP SUMOylation promotes ATR activation by providing a unique type of protein glue that boosts multiple protein interactions along the ATR pathway
24073851 Data on crystal structure of BRCA1 binding with phosphopeptides suggest that C-terminal domain of BRCA1 interacts with ATRIP and BAAT1 with preferences for specific side chains; in ATRIP, phospho-Ser239 and Phe242 are the main interacting residues.
23454212 Data indicate that ATRIP is a direct target gene of HIF-1, and the increased ATRIP then activates the ATR signaling pathway under hypoxia.
23345434 as an ATR-associated kinase, Nek1 enhances the stability and activity of ATR-ATRIP before DNA damage, priming ATR-ATRIP for a robust DNA damage response
23144622 our analysis exposes an overlapping clinical manifestation between the disorders but allows an expanded spectrum of clinical features for ATR-ATRIP Seckel Syndrome to be defined
20861269 ATRIP may function outside the context of the canonical ATR damage signaling pathway during HSV-1 infection to participate in the viral life cycle.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
17638878 ATRIP is a CDK2 substrate, and CDK2-dependent phosphorylation of S224 regulates the ability of ATR-ATRIP to promote cell cycle arrest in response to DNA damage
17616665 a direct physical interaction between BRCA1 and ATRIP is required for the checkpoint function of ATR
17339343 support the idea of a multistep model for ATR activation that requires separable localization and activation functions of ATRIP
16176973 The expression of dimerization-defective ATRIP diminishes the maintenance of replication forks during treatment with DNA replication inhibitors.
16027118 ATRIP oligomerization is essential for the function of the ATM and Rad3-related (ATR)-ATRIP complex, which exists in higher order oligomeric states within cells
15743907 ATRIP is required for ATR accumulation at intranuclear foci induced by DNA damage.
15527801 N-terminal domain of the ATRIP protein contributes to the cell cycle checkpoint by regulating the intranuclear localization of ATR
15451423 Collectively, our results suggest that the ATR-mediated phosphorylation of ATRIP at Ser-68 and -72 is dispensable for the initial response to DNA damage.
14724280 there are at least two in vitro ATR-ATRIP DNA binding complexes, one which binds DNA with high affinity in an RPA-dependent manner and a second, which binds DNA with lower affinity in an RPA-independent manner
12791985 data suggest that RPA-coated ssDNA is the critical structure at sites of DNA damage that recruits the ATR-ATRIP complex and facilitates its recognition of substrates for phosphorylation and the initiation of checkpoint signaling

AA Sequence

MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQA      1 - 70
LSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNG     71 - 140
EIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSE    141 - 210
RANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKP    211 - 280
HSLRGDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF    281 - 350
GSTLAGMSGLRTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL    351 - 420
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSG    421 - 490
AVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASV    491 - 560
LTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGC    561 - 630
LLLLLYMYITSRPDRVALETQWLQLEQEVVWLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLT    631 - 700
VRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEE    701 - 770
AALDDLCAAETDVEDPEVECG                                                     771 - 791
//

Text Mined References (59)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24990965 2014 SUMOylation of ATRIP potentiates DNA damage signaling by boosting multiple protein interactions in the ATR pathway.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24073851 2013 Structural basis for the BRCA1 BRCT interaction with the proteins ATRIP and BAAT1.
23454212 2013 HIF1-regulated ATRIP expression is required for hypoxia induced ATR activation.
23345434 2013 Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient DNA damage signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144622 2012 Identification of the first ATRIP-deficient patient and novel mutations in ATR define a clinical spectrum for ATR-ATRIP Seckel Syndrome.
22258451 2012 ATR-ATRIP kinase complex triggers activation of the Fanconi anemia DNA repair pathway.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
21859891 2011 BID binds to replication protein A and stimulates ATR function following replicative stress.
21777809 2011 ATR autophosphorylation as a molecular switch for checkpoint activation.
21615334 2011 ATR signalling: more than meeting at the fork.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20930849 2010 Cyclin-dependent kinase 9-cyclin K functions in the replication stress response.
20861269 2010 ATR and ATRIP are recruited to herpes simplex virus type 1 replication compartments even though ATR signaling is disabled.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616048 2010 Reconstitution of RPA-covered single-stranded DNA-activated ATR-Chk1 signaling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889979 2009 Functional genomic screens identify CINP as a genome maintenance protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519640 2008 TopBP1 activates ATR through ATRIP and a PIKK regulatory domain.
18283122 2008 Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17638878 2007 Cyclin-dependent kinase 2 dependent phosphorylation of ATRIP regulates the G2-M checkpoint response to DNA damage.
17616665 2007 Phosphorylation of ATR-interacting protein on Ser239 mediates an interaction with breast-ovarian cancer susceptibility 1 and checkpoint function.
17339343 2007 Function of a conserved checkpoint recruitment domain in ATRIP proteins.
17327276 2007 Perturbed gap-filling synthesis in nucleotide excision repair causes histone H2AX phosphorylation in human quiescent cells.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
17171639 2007 Centrosomal localization of DNA damage checkpoint proteins.
16959771 2006 Monoubiquitination of proliferating cell nuclear antigen induced by stalled replication requires uncoupling of DNA polymerase and mini-chromosome maintenance helicase activities.
16713580 2006 ATR kinase activation mediated by MutSalpha and MutLalpha in response to cytotoxic O6-methylguanine adducts.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16530042 2006 TopBP1 activates the ATR-ATRIP complex.
16407120 2006 ATRIP associates with replication protein A-coated ssDNA through multiple interactions.
16186122 2005 Phosphorylation of Chk1 by ATM- and Rad3-related (ATR) in Xenopus egg extracts requires binding of ATRIP to ATR but not the stable DNA-binding or coiled-coil domains of ATRIP.
16176973 2005 Dimerization of the ATRIP protein through the coiled-coil motif and its implication to the maintenance of stalled replication forks.
16027118 2005 ATRIP oligomerization is required for ATR-dependent checkpoint signaling.
15758953 2005 Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage.
15743907 2005 ATRIP binding to replication protein A-single-stranded DNA promotes ATR-ATRIP localization but is dispensable for Chk1 phosphorylation.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15527801 2004 Amino-terminal domain of ATRIP contributes to intranuclear relocation of the ATR-ATRIP complex following DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451423 2004 ATR-dependent phosphorylation of ATRIP in response to genotoxic stress.
15371427 2004 Claspin and the activated form of ATR-ATRIP collaborate in the activation of Chk1.
15210935 2004 Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.
14729973 2004 Quaternary structure of ATR and effects of ATRIP and replication protein A on its DNA binding and kinase activities.
14724280 2004 A novel protein activity mediates DNA binding of an ATR-ATRIP complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11721054 2001 ATR and ATRIP: partners in checkpoint signaling.
11278605 2001 Structure and expression of the TREX1 and TREX2 3' --> 5' exonuclease genes.
11181995 2001 The sequence of the human genome.