Property Summary

NCBI Gene PubMed Count 20
PubMed Score 34.34
PubTator Score 52.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.246 2.0e-02
astrocytoma -2.400 1.3e-02
ependymoma -1.400 3.0e-02
psoriasis -1.200 1.6e-07
glioblastoma -3.200 1.2e-05
oligodendroglioma -1.300 1.1e-08
osteosarcoma -2.594 1.7e-04
group 4 medulloblastoma -2.200 3.4e-05
atypical teratoid / rhabdoid tumor -4.200 5.1e-08
medulloblastoma, large-cell 2.700 4.1e-07
primitive neuroectodermal tumor -1.700 9.5e-03
hereditary spastic paraplegia -1.066 1.3e-02
limb girdle muscular dystrophy 2A -1.021 3.3e-04
adrenocortical carcinoma -1.139 7.2e-03
non-small cell lung cancer -2.534 1.6e-16
intraductal papillary-mucinous carcinoma... 1.200 1.9e-02
lung cancer -3.000 7.6e-07
pediatric high grade glioma -2.700 8.9e-07
pilocytic astrocytoma -1.700 1.2e-06
primary Sjogren syndrome 1.100 1.1e-03
Pick disease -2.400 2.0e-05
progressive supranuclear palsy -2.200 8.2e-03
Breast cancer -1.100 7.1e-03
ulcerative colitis -1.400 7.4e-06
ovarian cancer -2.400 1.7e-07
pituitary cancer 1.400 4.5e-04

Gene RIF (5)

PMID Text
25595798 Depletion of ATP8A1 impaired the asymmetric transbilayer distribution of phosphatidylserine in recycling endosomes, dissociated EHD1 from recycling endosomes, and generated aberrant endosomal tubules that appear resistant to fission.
23269685 the phospholipid flippase complex of ATP8A1 and CDC50A proteins has a role in cell migration
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17229723 APLT has a role in macrophage-induced nitrosylation/oxidation plays an important role in cell clearance

AA Sequence

MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLY      1 - 70
SQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRN     71 - 140
GAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVD    141 - 210
SLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNS    211 - 280
TSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFGLNFLTFIIL    281 - 350
FNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQ    351 - 420
FKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTA    421 - 490
VPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIV    491 - 560
RTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRAS    561 - 630
TSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCK    631 - 700
LLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKA    701 - 770
VICCRVSPLQKSEVVEMVKKQVKVVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYL    771 - 840
KNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGI    841 - 910
FERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLL    911 - 980
GNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGV    981 - 1050
FWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVVLGKSLTERAQLLKNVFKKNHVN   1051 - 1120
LYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPDEW                             1121 - 1164
//

Text Mined References (25)

PMID Year Title
25595798 2015 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23269685 2013 Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18088087 2008 Phosphoproteome of resting human platelets.
17229723 2007 Nitrosative stress inhibits the aminophospholipid translocase resulting in phosphatidylserine externalization and macrophage engulfment: implications for the resolution of inflammation.
15919184 2005 The type 4 subfamily of P-type ATPases, putative aminophospholipid translocases with a role in human disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11015572 1999 Differential expression of putative transbilayer amphipath transporters.
10198212 1999 Cloning, expression, and chromosomal mapping of a human ATPase II gene, member of the third subfamily of P-type ATPases and orthologous to the presumed bovine and murine aminophospholipid translocase.
9548971 1998 Multiple members of a third subfamily of P-type ATPases identified by genomic sequences and ESTs.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.