Property Summary

NCBI Gene PubMed Count 32
PubMed Score 16.74
PubTator Score 12.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.130 8.5e-03
astrocytic glioma -2.300 9.4e-03
ependymoma -2.300 1.6e-02
oligodendroglioma -1.500 4.3e-02
glioblastoma -1.600 3.2e-03
atypical teratoid / rhabdoid tumor -1.700 3.5e-08
medulloblastoma -1.500 5.7e-05
medulloblastoma, large-cell -1.800 1.8e-04
primitive neuroectodermal tumor -1.300 8.7e-04
adult high grade glioma -1.600 2.6e-05
pilocytic astrocytoma -1.100 5.6e-05
Pick disease -1.400 9.8e-04
ovarian cancer 1.600 3.3e-04

Gene RIF (9)

PMID Text
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21871445 ATP6V1H may represent a critical molecular mechanism involved in the development of type 2 diabetes and its compilations through its important regulatory effect on vacuolar-ATPase activity.
20488787 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
19815536 Data show that the BCG phagosome is relatively depleted in LAMP-2, NPC1, flotillin-1, vATPase, and syntaxin 3.
18368028 Our study shows that multiple mechanisms of pump dysfunction result from B1 subunit mutations with a common outcome being defective assembly
12058068 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
12032142 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
11463741 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs
9620685 HIV-1 Nef-induced activation of p61Hck is required for the formation of multinucleated giant cells (MGCs), which is dependent on lysosomal proteins including vacuolar adenosine triphosphatase and proteases participated in Nef-induced MGCs

AA Sequence

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG      1 - 70
SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM     71 - 140
AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR    141 - 210
VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK    211 - 280
VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS    281 - 350
SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH    351 - 420
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS           421 - 483
//

Text Mined References (35)

PMID Year Title
25659576 2015 TM9SF4 is a novel V-ATPase-interacting protein that modulates tumor pH alterations associated with drug resistance and invasiveness of colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21871445 2011 Decreased expression of ATP6V1H in type 2 diabetes: a pilot report on the diabetes risk study in Mexican Americans.
21269460 2011 Initial characterization of the human central proteome.
19815536 2010 The Mycobacterium bovis bacille Calmette-Guerin phagosome proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18368028 2008 The vacuolar-ATPase B1 subunit in distal tubular acidosis: novel mutations and mechanisms for dysfunction.
17897319 2007 Integral and associated lysosomal membrane proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16103193 2005 Human immunodeficiency virus Nef induces rapid internalization of the T-cell coreceptor CD8alphabeta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12539959 2002 Transport ATPases in biological systems and relationship to human disease: a brief overview.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163484 2002 The amino-terminal domain of the E subunit of vacuolar H(+)-ATPase (V-ATPase) interacts with the H subunit and is required for V-ATPase function.
12058068 2002 Subunit H of the V-ATPase involved in endocytosis shows homology to beta-adaptins.
12032142 2002 Subunit H of the V-ATPase binds to the medium chain of adaptor protein complex 2 and connects Nef to the endocytic machinery.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11179428 2001 Negative factor from SIV binds to the catalytic subunit of the V-ATPase to internalize CD4 and to increase viral infectivity.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
9620685 1998 Interactions between HIV1 Nef and vacuolar ATPase facilitate the internalization of CD4.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
2014052 1991 Serine phosphorylation-independent downregulation of cell-surface CD4 by nef.