Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.00
PubTator Score 6.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Cysts 41 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.9e-10
medulloblastoma, large-cell 6241 7.7e-04
lung carcinoma 2843 2.7e-03
sarcoidosis 370 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Osteoporosis 363 3.648 1.8
Craniometaphyseal dysplasia 5 3.565 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma -1.100 2.7e-03
medulloblastoma, large-cell 1.100 7.7e-04
psoriasis 1.800 3.9e-10
sarcoidosis 1.200 4.6e-02

Gene RIF (2)

AA Sequence

MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLANHTNPLTVSKI      1 - 70
DTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKKSVKEILGKCHPLGRFTEMEA     71 - 140
VNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIELLRNKLYKSYLEAFYKFCKNHGDVTAEVMCP    141 - 210
ILEFEADRRAFIITLNSFGTELSKEDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEA    211 - 280
VGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL    281 - 350
//

Text Mined References (18)

PMID Year Title