Property Summary

NCBI Gene PubMed Count 69
PubMed Score 192.88
PubTator Score 104.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (20)

Disease log2 FC p
Parkinson's disease -1.300 4.9e-02
acute quadriplegic myopathy 1.843 2.8e-06
Alzheimer's disease -1.100 2.6e-02
Amyotrophic lateral sclerosis 1.015 1.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.681 1.6e-03
Breast cancer 3.800 2.2e-02
dermatomyositis 1.700 1.8e-03
Duchenne muscular dystrophy 1.677 1.1e-07
fascioscapulohumeral muscular dystrophy 1.131 6.9e-04
juvenile dermatomyositis 1.774 3.8e-14
lung adenocarcinoma 1.447 3.1e-07
lung cancer -1.400 7.4e-03
malignant mesothelioma -1.400 1.5e-06
medulloblastoma, large-cell -1.400 8.7e-04
Multiple myeloma 1.176 1.6e-02
osteosarcoma 3.137 3.1e-07
ovarian cancer -1.400 1.2e-04
Pick disease -1.300 1.4e-05
primary pancreatic ductal adenocarcinoma 1.099 1.6e-02
primary Sjogren syndrome 1.200 5.0e-02

Gene RIF (58)

AA Sequence

MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFH      1 - 70
RPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKA     71 - 140
NSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPD    141 - 210
LYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTI    211 - 280
LEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD    281 - 350
//

Text Mined References (74)

PMID Year Title