Property Summary

NCBI Gene PubMed Count 27
PubMed Score 168.72
PubTator Score 63.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0
Disease Target Count Z-score Confidence
Autoimmune thyroiditis 24 4.568 2.3
Hypothyroidism 89 3.938 2.0

Expression

Gene RIF (10)

PMID Text
26876430 Upon IF1 interaction with the ATP synthase both the synthetic and hydrolytic activities of the engine of oxidative phosphorylation are inhibited. (Review)
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23046812 Sirt3 physically interacted with the OSCP and led to its subsequent deacetylation.
22190034 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19274082 Genetic variation and age are associated with skeletal muscle ATP5O mRNA expression and glucose disposal rate, suggesting that combinations of genetic and non-genetic factors may cause the reduced expression of ATP5O in type 2 diabetes muscle
19274082 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
12110673 Human mitochondrial F(1)F(0) ATP synthase was isolated with a one-step immunological approach.

AA Sequence

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK      1 - 70
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP     71 - 140
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR    141 - 210
EIV                                                                       211 - 213
//

Text Mined References (31)

PMID Year Title
26876430 2016 The ATPase Inhibitory Factor 1 (IF1): A master regulator of energy metabolism and of cell survival.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23046812 2013 Regulation of mitochondrial F(o)F(1)ATPase activity by Sirt3-catalyzed deacetylation and its deficiency in human cells harboring 4977bp deletion of mitochondrial DNA.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19274082 2009 Genetic variation in ATP5O is associated with skeletal muscle ATP50 mRNA expression and glucose uptake in young twins.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17851741 2007 IF(1) distribution in HepG2 cells in relation to ecto-F(0)F (1)ATPsynthase and calmodulin.
17571346 2007 Identification and analysis of functional elements in 1% of the human genome by the ENCODE pilot project.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
15850986 2005 Identification and validation of the mitochondrial F1F0-ATPase as the molecular target of the immunomodulatory benzodiazepine Bz-423.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
10830953 2000 The DNA sequence of human chromosome 21.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7750094 1995 Identification of novel genes from stomach cancer cell lines by differential display.
7490082 1995 Cloning of the cDNA for the human ATP synthase OSCP subunit (ATP5O) by exon trapping and mapping to chromosome 21q22.1-q22.2.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.