Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 3.4e-15
diabetes mellitus 1663 1.4e-03
breast carcinoma 1614 2.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.300 2.8e-02
diabetes mellitus -1.100 1.4e-03
lung adenocarcinoma 1.400 3.4e-15

AA Sequence

MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE                         1 - 51
//

Text Mined References (3)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
15057823 2004 The DNA sequence and analysis of human chromosome 13.