Property Summary

NCBI Gene PubMed Count 39
PubMed Score 94.05
PubTator Score 177.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma 1.981 1.6e-02
Barrett's esophagus 1.600 2.6e-02
colon cancer -1.200 3.6e-02
cystic fibrosis -1.300 5.0e-04
ductal carcinoma in situ 1.100 4.3e-02
interstitial cystitis 2.000 3.6e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.0e-02
lung cancer -1.100 7.9e-03
lung carcinoma 1.600 1.8e-22
medulloblastoma, large-cell 1.100 7.2e-04
osteosarcoma -3.974 3.9e-06
periodontitis 1.200 5.4e-22
psoriasis -1.700 4.7e-07

Gene RIF (30)

AA Sequence

MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAAL      1 - 70
VSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRI     71 - 140
RARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFS    141 - 210
GTNITSGKAVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFA    211 - 280
DPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICS    281 - 350
DKTGTLTTNQMSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC    351 - 420
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRD    421 - 490
RKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLR    491 - 560
CLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKG    561 - 630
TAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAM    631 - 700
TGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVG    701 - 770
EVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAI    771 - 840
GVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMALSVLVTIEMC    841 - 910
NALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILL    911 - 980
DEALKYLSRNHMHACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD           981 - 1043
//

Text Mined References (44)

PMID Year Title