Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5982.80
PubTator Score 77.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 9.6e-11
psoriasis 6685 7.7e-05
cystic fibrosis 1670 1.4e-04
cutaneous lupus erythematosus 1056 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 4.500 7.7e-05
cutaneous lupus erythematosus 2.800 1.5e-02
cystic fibrosis -1.200 1.4e-04
nasopharyngeal carcinoma -2.400 9.6e-11

Gene RIF (11)

PMID Text
26823428 expressing human ATP12A in cystic fibrosis mouse airways acidified airway surface liquid, impaired defenses, and increased airway bacteria.
25366262 Genetic association studies show that carriers of ATP12A rs10507337 C allele or CCTTC haplotype had better pattern of myocardial relaxation as compared to non-carriers.
22179016 No significantly different expression levels could be detected in the various disease states compared to normal tissue.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19694409 Use of fold recognition methods enables a prediction that the C-terminal domain of the beta subunits of Na,K-ATPase and H,K-ATPase has an immunoglobulin-like fold, which resembles cell adhesion molecules.
19487957 Inhibition of the ATP1AL1 isoenzyme of sodium potassium exchanging ATPase by 8-coumestrol is reported.
15135233 non-gastric H(+)/K(+)ATPase is present in the microvillous plasma membrane of the transporting epithelia of the human placenta
15086469 Carboxy-terminus of HKalpha(2) facilitates proper folding of tHKalpha(2)/beta(1) complex allowing translocation of heterodimer to plasma membrane where potassium uptake occurs. Otherwise, alpha/beta complex is destined for degradation.
12230809 Expressed in distal part of human colon and rectum, but also in proximal part of colon. Overexpressed in human colorectal adenocarcinomas adenocarcinomas. Astonishing levels of mRNA overexpression in carcinoma.
12110518 Stimulation of protein kinase C pathway mediates endocytosis of human nongastric H+-K+-ATPase, ATP1AL1.
11880279 The presence of nongastric H-K-ATPase in rodent prostate apical membranes may indicate its involvement in potassium concentration regulation in secretions of these glands.

AA Sequence

MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKY      1 - 70
GTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSA     71 - 140
SLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKG    141 - 210
GDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRT    211 - 280
IIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEG    281 - 350
LLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED    351 - 420
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILGDVMEIRKRNR    421 - 490
KVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMINGEEHPLDKSTAKTFHTAYMEL    491 - 560
GGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIM    561 - 630
VTGDHPITAKAIAKSVGIISANSETVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANY    631 - 700
QEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNF    701 - 770
ASIVTGVEEGRLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE    771 - 840
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLINLRVEWEKDYV    841 - 910
NDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGITSQIII    911 - 980
GLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEVRKLFIRLYPGSWWDKNMYY               981 - 1039
//

Text Mined References (27)

PMID Year Title
26823428 2016 Airway acidification initiates host defense abnormalities in cystic fibrosis mice.
25366262 2014 Left ventricular diastolic function associated with common genetic variation in ATP12A in a general population.
25322912 2014 The putative role of the non-gastric H?/K?-ATPase ATP12A (ATP1AL1) as anti-apoptotic ion transporter: effect of the H?/K? ATPase inhibitor SCH28080 on butyrate-stimulated myelomonocytic HL-60 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22179016 2011 Expression of the non-gastric H+/K+ ATPase ATP12A in normal and pathological human prostate tissue.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19694409 2009 A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules.
19487957 2009 Inhibition of the alpha1beta1 isoform of the Na, K-ATPase by 8-methoxycoumestrol without positive inotropic effect in human myocardium--novel aspects of cardiac glycoside pharmacology.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15135233 2004 Non-gastric H+/K+ ATPase is present in the microvillous membrane of the human placental syncytiotrophoblast.
15086469 2004 The carboxy terminus of the colonic H(+), K(+)-ATPase alpha-subunit is required for stable beta subunit assembly and function.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230809 2002 Expression of ATP1AL1, a non-gastric proton pump, in human colorectum.
11880279 2002 Nongastric H-K-ATPase in rodent prostate: lobe-specific expression and apical localization.
9872395 1998 Ouabain-sensitive H,K-ATPase: tissue-specific expression of the mammalian genes encoding the catalytic alpha subunit.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838794 1996 Genomic organization of the human ATP1AL1 gene encoding a ouabain-sensitive H,K-ATPase.
8045293 1994 Cloning and characterization of the entire cDNA encoded by ATP1AL1--a member of the human Na,K/H,K-ATPase gene family.
3036582 1987 The family of human Na+,K+-ATPase genes. No less than five genes and/or pseudogenes related to the alpha-subunit.
3035563 1987 Multiple genes encode the human Na+,K+-ATPase catalytic subunit.
2842249 1988 Chromosomal localization of human Na+, K+-ATPase alpha- and beta-subunit genes.
1847115 1991 The family of human Na,K-ATPase genes. ATP1AL1 gene is transcriptionally competent and probably encodes the related ion transport ATPase.