Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.10
PubTator Score 4.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.049 3.8e-02
osteosarcoma -1.941 2.9e-05
atypical teratoid / rhabdoid tumor 1.600 2.3e-07
glioblastoma 1.400 7.3e-04
group 4 medulloblastoma 1.200 6.8e-05
medulloblastoma, large-cell 1.700 3.6e-05
non-small cell lung cancer 2.254 2.8e-19
intraductal papillary-mucinous adenoma (... 2.100 1.8e-04
intraductal papillary-mucinous carcinoma... 1.900 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.9e-03
pediatric high grade glioma 1.200 3.7e-04
psoriasis 1.600 5.1e-38
spina bifida -1.053 4.3e-02
Breast cancer -1.200 1.4e-04
invasive ductal carcinoma 1.100 2.6e-02
ovarian cancer 1.700 6.3e-12

Gene RIF (2)

PMID Text
23585472 colocalization of ATP11B with fluorescent cisplatin and with vesicular trafficking proteins, such as STX6 and VAMP4, strongly suggests that ATP11B contributes to secretory vesicular transport of cisplatin from Golgi to plasma membrane
11790799 the region containing transmembrane domain 4, corresponding to exon 12, is present in the human homolog of the gene, ATP11B

AA Sequence

MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLFEQFRRVANFY      1 - 70
FLIIFLVQLMIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNI     71 - 140
RVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETALLQTVANLDTLVAVIEC    141 - 210
QQPEADLYRFMGRMIITQQMEEIVRPLGPESLLLRGARLKNTKEIFGVAVYTGMETKMALNYKSKSQKRS    211 - 280
AVEKSMNTFLIIYLVILISEAVISTILKYTWQAEEKWDEPWYNQKTEHQRNSSKILRFISDFLAFLVLYN    281 - 350
FIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFR    351 - 420
ECSINGMKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFK    421 - 490
AVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYYASSPDEKALVEAAARIGIVFIGNSEETMEVKTLGK    491 - 560
LERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESSILPKCIGGEIEKTRIHVDEFALKGLRTLCI    561 - 630
AYRKFTSKEYEEIDKRIFEARTALQQREEKLAAVFQFIEKDLILLGATAVEDRLQDKVRETIEALRMAGI    631 - 700
KVWVLTGDKHETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLS    701 - 770
LALREHEKLFMEVCRNCSAVLCCRMAPLQKAKVIRLIKISPEKPITLAVGDGANDVSMIQEAHVGIGIMG    771 - 840
KEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYCLFSQQTLYDS    841 - 910
VYLTLYNICFTSLPILIYSLLEQHVDPHVLQNKPTLYRDISKNRLLSIKTFLYWTILGFSHAFIFFFGSY    911 - 980
LLIGKDTSLLGNGQMFGNWTFGTLVFTVMVITVTVKMALETHFWTWINHLVTWGSIIFYFVFSLFYGGIL    981 - 1050
WPFLGSQNMYFVFIQLLSSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSM   1051 - 1120
CCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC                1121 - 1177
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23585472 2013 ATP11B mediates platinum resistance in ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17456239 2007 Discovery of tissue-specific exons using comprehensive human exon microarrays.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15919184 2005 The type 4 subfamily of P-type ATPases, putative aminophospholipid translocases with a role in human disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15071553 2004 Biology, structure and mechanism of P-type ATPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790799 2002 Reanalysis of ATP11B, a type IV P-type ATPase.
11015572 1999 Differential expression of putative transbilayer amphipath transporters.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.