Property Summary

NCBI Gene PubMed Count 138
PubMed Score 165.79
PubTator Score 159.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.398 5.0e-04
tuberculosis and treatment for 6 months 1.300 4.0e-04
Pick disease 1.100 1.2e-04

Protein-protein Interaction (6)

Gene RIF (144)

PMID Text
26837467 Knockdown of Atg16L1, a crucial autophagy gene, leads to developmental retention of early-stage cells in various tissues where the differentiation of stem cells is retarded.
26226011 Subjects homozygous for the autophagy-related 16-like protein (ATG16L1) CD-associated gene variant (rs2241880), had low SHIP mRNA expression and activity.
26165754 The signaling axis of HIF-1a, miR-20a-5p, and ATG16L1 in autophagic process might be a critical adapting mechanism for ischemic kidney injury.
26095365 Antibacterial autophagy is impaired in CLEC12A-deficient cells, and this effect is exacerbated in the presence of the ATG16L1( *)300A risk allele.
26083323 ATG16L1 as a bona fide physiological CSNK2 and PPP1 substrate, which reveals a novel molecular link from CSNK2 to activation of the autophagy-specific ATG12-ATG5-ATG16L1 complex and autophagy induction
25886994 decreased expression in colon biopsies of Crohn's disease patients; conversely, increased expression in ulcerative colitis patients
25883416 CNTNAP3 could upregulate the expression of ATG16L1 and increase autophagy vacuoles
25767270 ATG16L1 expression could influence vascular endothelial function during atherogenesis.
25738374 ATG16L1 variant rs2241880 was associated with 38% increase in the risk for Crohn's disease for higher mutational load, whereas IL23R variant rs11209026 decreased the risk by 54% for higher mutational load.
25712183 genotyped 31 Crohn's disease (CD)-associated genes in 102 Slovenian patients. The strongest association for treatment response defined as decrease in CRP levels was found for ATG16L1 SNP rs10210302.
25645662 The Thr300Ala variant in ATG16L1 is associated with improved survival in human colorectal cancer and enhanced production of type I interferon.
25461811 These two steps are essential for the maturation of small single-membrane autophagic precursors containing ATG16L1 and mATG9 proteins into double-membrane autophagosomes
25253126 CD patients homozygous for the ATG16L1-T300A risk allele show impaired clearance of pathosymbionts in ileal inflammation indicating that ATG16L1 is essential for effective elimination of pathosymbionts upon inflammation.
25233411 Data suggest ATG16L1 dimer interacts with WIPI2b (WD repeat domain phosphoinositide-interacting protein 2) and this interaction is linked to phosphatidylinositol 3-phosphate production in endoplasmic reticulum and autophagosome formation. [REVIEW]
25159710 results showed that the prevalence of ATG16L1 and IL23R variants was not significantly different between patients and controls. However a possible role of ATG16L1 (T300A) on CD phenotype was suggested
25060858 ATG16L1 may be used as a biomarker for selecting oral squamous cell carcinoma patients with a more aggressive phenotype.
25048429 ATG16L1 gene does play a role in the pathogenesis of Crohn's Disease in the Chinese population.
25003259 The frequency of the allele G of the polymorphism T300A was higher in the group of patients with Crohn's disease (48.6%) than in controls (42.4%), although not reaching statistical significance.
24791954 Carriage of the minor A allele of ATG16L1 was associated with septic shock with at least one organ failure (odds ratio (OR): 2.40, p: 0.036).
24715166 Subjects carrying GG genotype were at a higher risk for colorectal cancer (OR 1.99, 95% CI: 1.02-3.91, p=0.039) when compared with the more frequent AA genotype.
24713404 Despite moderate effects on the modulation of proinflammatory cytokine production, genetic variation in the autophagy genes ATG16L1 and IRGM has a minor impact on the susceptibility to both mucosal and systemic Candida infections.
24656308 this is the first paediatric study reporting an association between the presence of the rs2241880 risk polymorphism of ATG16L1 in children with CD and a more severe phenotype of the disease.
24627602 Monocytes of Crohn's disease patients show enhanced phagocytosis associated with the presence of ATG16L1 and NOD2 variants.
24563254 Data indicate that human ATG16L1 and mouse autophagy components Atg7 and Atg16L1, but participate in the IFN-gamma-induced recruitment of the immunity-related GTPases to the intracellular pathogen.
24553140 findings demonstrate that caspase 3 activation in the presence of a common risk allele leads to accelerated degradation of ATG16L1, placing cellular stress, apoptotic stimuli and impaired autophagy in a unified pathway that predisposes to Crohn's disease
24522266 Presence of Mycobacterium avium subspecies paratuberculosis, rs2241880 (ATG16L1) and rs10045431 (IL12B) were found to be significantly associated with Crohn's disease.
24401604 MIR142-3p, upon transient overexpression in the cells, resulted in decreased ATG16L1 mRNA and protein levels
24238340 The Crohn-disease-associated ATG16L1 allele had impaired ability to regulate Nod-driven inflammation. Disruption could contribute to the chronic inflammation associated with CD. ATG16L1 also regulates bacterial-infected intestinal epithelial cells.
24086718 The N-terminal region of the human autophagy protein ATG16L1 contains a domain that folds into a helical structure consistent with formation of a coiled-coil.
24076061 The T300A allele was associated with abnormal paneth cells in Crohn's disease.
24036151 Levels of ATG16L1 were reduced in colon samples of patients with active Crohn's disease compared with controls.
24022642 T300A variant of autophagy ATG16L1 gene is associated with decreased antigen sampling and processing by dendritic cells in pediatric Crohn's disease.
24012056 The Egr-1 and Atg16L1 genes' polymorphisms were significant risk factors for susceptibility to chronic obstructive pulmonary disease (COPD) . These results demonstrate that autophagy regulator genetic mutations are associated with COPD in male smokers.
23964099 The ATG16L1 T300A polymorphism defines a specific subtype of patients with Crohn's disease, characterised by Paneth cell endoplasmic reticulum stress even during quiescent disease.
23850724 our results present initial evidence that AI of the NOD2 and ATG16L1 genes exists in populations of human DCs
23633462 The mean hours from induction to delivery was 20.8 (9.7) for women who were A,A homozygotes, 19.2 (8.8) for A,G heterozygotes and 14.3 (6.6) for homozygote carriers of the G,G variant SNP in ATG16L1 (rs2241880).
23535819 Letter: ATG16L1 rs2241880 genetic polymorphism does not confer predisposition to rheumatoid arthritis.
23512522 Different domains of Atg16L1 play different roles in the process of autophagy.
23439083 High levels of additive and synergic antiretroviral activity are obtained by using antiretroviral compounds (T1249, 3TC, RAL, or IDV) in PM1 cells stably expressing anti-host shRNAs (IPO7, HSPD1, or ATG16) or anti-HIV shRNAs (Pol, RT, or Nef)
23439083 High levels of additive and synergic antiretroviral activity are obtained by using antiretroviral compounds (T1249, 3TC, RAL, or IDV) in PM1 cells stably expressing anti-host shRNAs (IPO7, HSPD1, or ATG16) or anti-HIV shRNAs (Pol, RT, or Nef)
23376921 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
23262492 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
22885761 findings reveal that individuals carrying the Crohn disease risk ATG16L1*300A allele are more susceptible to H. pylori infection and have impaired autophagy responses, resulting in reduced initial autophagic clearance of the infecting bacteria
22573572 In a Portuguese population, SNPs at three autophagy-related genes, ATG16L1, IRGM, and ITLN1, contribute to predict Crohn's ileal or ileocolonic disease, involvement of the upper digestive tract, and response to treatment.
22370477 gene affect autophagy and increase adaptive immunity in patients with Crohn's disease who carry ATG16L1 risk alleles
22346247 role of ATG16L, NOD2 and IL23R in Crohn's disease [review]
22302078 The 300Ala (G) allele of ATG16L1 is associated with decreased risk for epithelial cell-derived thyroid carcinoma in a Dutch population
22275320 ATG16L1 T300A Variant is associated with increased anti-Saccharomyces cerevisiae antibodies in Crohn's disease.
21987459 Loss of ATG16L1 is associated with the onset and perpetuation of chronic intestinal inflammation.
21879234 The present study is the first report addressing a possible impact of the ATG16L1 gene on the risk of psoriasis.
21734790 Data show that Crohn's disease-associated polymorphisms affected the elimination of mycobacterium avium subspecies paratuberculosis from monocytes (NOD2), or expression of certain cytokines (ATG16L1), implying independent roles in CD pathogenesis.
21674723 Genetic Polymorphism in ATG16L1 is not associated with Crohn's disease.
21618365 This is the first report of sex-specific Crohn's disease association for ATG16L1.
21513755 The current study provides evidence of an association of the ATG16L1 gene in susceptibility to palmoplantar pustulosis.
21406388 The present study is the first to link the ATG16L1 polymorphism with an excessive production of IL-1beta and IL-6 in humans, which may explain the effects of this polymorphism on the inflammatory process in Crohn's disease.
21206965 IL23R, NOD2/CARD15, ATG16L1 and PHOX2B polymorphisms in a group of patients with Crohn's disease and correlation with sub-phenotypes.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20875485 polymorphisms in ATG16L1 and NOD2, we may find that some of these risk factors affect the same pathway. What if this epistatic relationship between NOD2 and ATG16L1 is representative of disease risk factors
20846217 Observational study of gene-disease association. (HuGE Navigator)
20839241 Observational study of gene-disease association. (HuGE Navigator)
20722066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20697744 Observational study of gene-disease association. (HuGE Navigator)
20639872 Data show in mammalian cells that the heavy chain of clathrin interacts with Atg16L1 and is involved in the formation of Atg16L1-positive early autophagosome precursors.
20637199 ATG16L1 and NOD2 are components of an autophagy-mediated antibacterial pathway that is altered in a cell- and function-specific manner by CD-associated mutations.
20485703 ATG16L1 is relevant to inflammatory bowel disease in the Asian population.
20485703 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
20395867 The association of the ATG16L1 variant and IRGM variants with Crohn's disease was confirmed. No evidence for gene-gene interaction between ATG16L1 and IRGM and granuloma formation was found.
20395867 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20380008 the frequency of G allele of the rs2241880 ATG16L1 polymorphism was increased in both paediatric and adult Crohn's disease patients compared to controls
20380008 Observational study of gene-disease association. (HuGE Navigator)
20222171 The ATG16L1 T300A polymorphism contributes to susceptibility to Crohn's disease and ulcerative colitis in adults.
20222171 Meta-analysis of gene-disease association. (HuGE Navigator)
20082483 Observational study of gene-disease association. (HuGE Navigator)
20066736 Logistic regression analysis of pairwise interaction of the inflammatory bowel disease (IBD) loci indicated that IL23R, ATG16L1, and CARD15 contribute independently to disease risk.
20066736 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20024904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20014019 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19898471 Results link bacterial sensing by Nod proteins to the induction of autophagy and provide a functional link between Nod2 and ATG16L1.
19783656 Atg16L1 T300A is differentially involved in Crohn disease and canonical autophagy
19760754 Observational study of gene-disease association. (HuGE Navigator)
19683022 no evidence of association with celiac disease has been reported for the Crohn's disease susceptibility polymorphisms studied in the NKX2-3, ATG16L1, and IRGM genes.
19683022 Observational study of gene-disease association. (HuGE Navigator)
19659808 We confirmed the association of Crohn's disease with ATG16L1 rs2241880 variant in early-onset CD.
19659808 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19590455 ATG16L1 p.197Ala allele conferred increased risk of CD (allelic frequency 60% in patients vs 51% in controls; OR 1.25, 95% CI 1.02-1.52, P=0.03).
19590455 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19575361 The Thr300Ala polymorphism is associated with Crohn's disease, but not with ulcerative colitis
19491842 the ATG16L1 rs2241880 and IRGM rs13361189 and rs4958847 polymorphisms are important markers for Crohn's disease susceptibility and indicate that these variants are also associated with ulcerative colitis.
19491842 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19337756 The G allele of ATG16L1 T300A is a low-penetrant gene for Crohn's disease in Caucasians.
19337756 Meta-analysis of gene-disease association. (HuGE Navigator)
19334001 Observational study of gene-disease association. (HuGE Navigator)
19276991 Genetic variants in IL-23R and ATG16L1 independently predispose to increased susceptibility to Crohn's disease in a Canadian population.
19276991 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19269148 gene polymorphism is associated with Crohn's disease
19262523 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19235913 Observational study of gene-disease association. (HuGE Navigator)
19174780 genetic associations for CD with IL23R, ATG16L1, IRGM, NKX2-3, 1q24, 10q21, 5p13, and PTPN2 and report evidence for associations with HERC2 and CCNY.
19174780 Observational study of gene-disease association. (HuGE Navigator)
19139628 One role for the autophagy pathway in Crohn disease pathogenesis is through selective effects on the biology and specialized properties of Paneth cells.
19120485 associated with predisposition to Crohn's disease
18985712 We have confirmed associations between Crohn disease and ATG16L1 in a pediatric cohort of Canadian children
18985712 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18852889 the association of ATG16L1*300A with increased risk of Crohn's disease is due to impaired bacterial handling and lowered rates of bacterial capture by autophagy.
18849966 ATG16L1 deficient Paneth cells exhibited notable abnormalities in the granule exocytosis pathway
18824555 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18715515 Observational study of gene-disease association. (HuGE Navigator)
18698678 There is an association of IL23R polymorphisms with inflammatory bowel disease, and ATG16L1 with Crohn's disease, in both adult- and pediatric-onset subsets in our italian study population.
18698678 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18671817 A greater than seven-fold increased CD risk was observed for current smokers with a GG genotype (vs nonsmoking AA genotype). A significant inverse association was found between T300A and UC. This was strongest for patients with extensive, severe disease.
18671817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18521924 Observational study of gene-disease association. (HuGE Navigator)
18521914 ATG16L1, IBD5, and IL23R SNPs were significantly associated with Crohn's Disease
18521914 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18499543 ATG16L1 gene is asscociated with Crohn disease susceptibility in Hungarian patients.
18499543 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18495612 Observational study of gene-disease association. (HuGE Navigator)
18448665 Rab33 modulates autophagosome formation through interaction with Atg16L
18438406 Observational study of gene-disease association. (HuGE Navigator)
18366306 review of recent advances in genome-wide association studies of inflammatory bowel disease, with specific focus on growing evidence of the ATG16L1 gene's role in Crohn's disease [review]
18338763 Observational study of gene-disease association. (HuGE Navigator)
18200510 No genotype-phenotype correlations were found among the Brazilian CD population with with ATG16L1.
18200510 Observational study of gene-disease association. (HuGE Navigator)
18166373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18162085 ATG16L1 is a CD susceptibility gene without epistatic interaction
18162085 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18088053 The ATG16L1 variant is associated with susceptibility to adult CD in Scotland, but not early-onset disease.
18088053 Observational study of gene-disease association. (HuGE Navigator)
18047540 confirmed the association of IL23R and ATG16L1 with CD susceptibility and also the association of IL23R with UC. We found IL23R and ATG16L1 were not associated with celiac disease susceptibility.
17921695 ATG16L1 is significantly associated with Crohn disease.
17894849 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17894849 ATG16L1 T300A is strongly associated with Crohn's disease in New Zealand Caucasians with inflammatory bowel disease.
17625155 we have replicated the association of allele G of rs2241880 in the ATG16L1 gene with Crohn's disease by demonstrating its effect in the childhood form of the disorder
17534574 Observational study of gene-disease association. (HuGE Navigator)
17534574 No evidence of positive association of ATG16L1 with Crohn's disease was found in the Japanese population.
17484864 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17484864 The association of ATG16L1 with Crohn's disease and possibly with ulcerative colitis supports a role for autophagy in the pathogenesis of inflammatory bowel disease.
17455206 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17200669 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17200669 A genome-wide association scan of nonsynonymous SNPs identifies a susceptibility variant for Crohn disease in ATG16L1.
15620219 Contains a coiled-coil domain and a motif with seven WD repeats, which are also shared by mouse Apg16L.

AA Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEIS      1 - 70
PGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISD     71 - 140
LETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENE    141 - 210
KDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSIT    211 - 280
NIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWE    281 - 350
VFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN    351 - 420
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGK    421 - 490
ITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYI    491 - 560
WSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY                           561 - 607
//

Text Mined References (145)

PMID Year Title
26837467 2016 Autophagy regulates Notch degradation and modulates stem cell development and neurogenesis.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26226011 2015 The Crohn's disease-associated polymorphism in ATG16L1 (rs2241880) reduces SHIP gene expression and activity in human subjects.
26165754 2015 MiR-20a-5p mediates hypoxia-induced autophagy by targeting ATG16L1 in ischemic kidney injury.
26095365 2015 Integrated Genomics of Crohn's Disease Risk Variant Identifies a Role for CLEC12A in Antibacterial Autophagy.
26083323 2015 ATG16L1 phosphorylation is oppositely regulated by CSNK2/casein kinase 2 and PPP1/protein phosphatase 1 which determines the fate of cardiomyocytes during hypoxia/reoxygenation.
25886994 2015 MicroRNA signatures differentiate Crohn's disease from ulcerative colitis.
25883416 2015 CNTNAP3 associated ATG16L1 expression and Crohn's disease.
25767270 2015 ATG16L1 Expression in Carotid Atherosclerotic Plaques Is Associated With Plaque Vulnerability.
25738374 2015 ATG16L1 and IL23R variants and genetic susceptibility to crohn's disease: mode of inheritance based on meta-analysis of genetic association studies.
25712183 2015 Genetic polymorphism in ATG16L1 gene influences the response to adalimumab in Crohn's disease patients.
25645662 2016 The Thr300Ala variant in ATG16L1 is associated with improved survival in human colorectal cancer and enhanced production of type I interferon.
25461811 2015 Methods to analyze SNARE-dependent vesicular fusion events that regulate autophagosome biogenesis.
25253126 2015 The ATG16L1-T300A allele impairs clearance of pathosymbionts in the inflamed ileal mucosa of Crohn's disease patients.
25233411 2014 WIPI2b and Atg16L1: setting the stage for autophagosome formation.
25159710 2014 IL23R and ATG16L1 variants in Moroccan patients with inflammatory bowel disease.
25060858 2015 Overexpression of autophagy-related 16-like 1 in patients with oral squamous cell carcinoma.
25048429 2014 Association of IL23R and ATG16L1 with susceptibility of Crohn's disease in Chinese population.
25003259 T300A genetic polymorphism: a susceptibility factor for Crohn's disease?
24954904 2014 WIPI2 links LC3 conjugation with PI3P, autophagosome formation, and pathogen clearance by recruiting Atg12-5-16L1.
24791954 2014 Association of autophagy-related 16-like 1 (ATG16L1) gene polymorphism with sepsis severity in patients with sepsis and ventilator-associated pneumonia.
24715166 2014 Determination of autophagy gene ATG16L1 polymorphism in human colorectal cancer.
24713404 2014 Role of autophagy genetic variants for the risk of Candida infections.
24656308 2014 Autophagy genes variants and paediatric Crohn's disease phenotype: a single-centre experience.
24627602 2014 ATG16L1 and NOD2 polymorphisms enhance phagocytosis in monocytes of Crohn's disease patients.
24563254 2014 Role of mouse and human autophagy proteins in IFN-?-induced cell-autonomous responses against Toxoplasma gondii.
24553140 2014 A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3.
24522266 2014 Detection of Mycobacterium avium subspecies paratuberculosis in patients with Crohn's disease is unrelated to the presence of single nucleotide polymorphisms rs2241880 (ATG16L1) and rs10045431 (IL12B).
24401604 2014 Human autophagy gene ATG16L1 is post-transcriptionally regulated by MIR142-3p.
24238340 2013 The protein ATG16L1 suppresses inflammatory cytokines induced by the intracellular sensors Nod1 and Nod2 in an autophagy-independent manner.
24086718 2013 The N-terminal region of the human autophagy protein ATG16L1 contains a domain that folds into a helical structure consistent with formation of a coiled-coil.
24076061 2014 Genetic variants synthesize to produce paneth cell phenotypes that define subtypes of Crohn's disease.
24036151 2014 MIR106B and MIR93 prevent removal of bacteria from epithelial cells by disrupting ATG16L1-mediated autophagy.
24022642 2013 T300A variant of autophagy ATG16L1 gene is associated with decreased antigen sampling and processing by dendritic cells in pediatric Crohn's disease.
24012056 2015 Association of Egr-1 and autophagy-related gene polymorphism in men with chronic obstructive pulmonary disease.
23964099 2014 Genomic ATG16L1 risk allele-restricted Paneth cell ER stress in quiescent Crohn's disease.
23850724 2013 Evidence of expression variation and allelic imbalance in Crohn's disease susceptibility genes NOD2 and ATG16L1 in human dendritic cells.
23633462 2013 A polymorphism in an autophagy-related gene, ATG16L1, influences time to delivery in women with an unfavorable cervix who require labor induction.
23535819 2014 Lack of association of the autophagy-related gene polymorphism ATG16L1 rs2241880 in RA predisposition.
23512522 2013 Three isoforms of the Atg16L1 protein contribute different autophagic properties.
23392225 2013 FIP200 regulates targeting of Atg16L1 to the isolation membrane.
23376921 2013 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
23262492 2013 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22885761 2012 Crohn disease ATG16L1 polymorphism increases susceptibility to infection with Helicobacter pylori in humans.
22573572 2013 Phenotype-genotype profiles in Crohn's disease predicted by genetic markers in autophagy-related genes (GOIA study II).
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22370477 2012 Autophagy attenuates the adaptive immune response by destabilizing the immunologic synapse.
22346247 2012 Role of ATG16L, NOD2 and IL23R in Crohn's disease pathogenesis.
22302078 2012 The effect of the ATG16L1 Thr300Ala polymorphism on susceptibility and outcome of patients with epithelial cell-derived thyroid carcinoma.
22275320 2012 Pattern recognition receptor and autophagy gene variants are associated with development of antimicrobial antibodies in Crohn's disease.
21987459 2012 Protein tyrosine phosphatase nonreceptor type 2 regulates autophagosome formation in human intestinal cells.
21879234 2012 Polymorphisms in the ATG16L1 gene are associated with psoriasis vulgaris.
21808068 2011 RUTBC1 protein, a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.
21734790 2011 NOD2 and ATG16L1 polymorphisms affect monocyte responses in Crohn's disease.
21674723 2011 ATG16L1 contribution to Crohn's disease risk in Sicily.
21618365 2012 Transmission distortion in Crohn's disease risk gene ATG16L1 leads to sex difference in disease association.
21513755 2011 ATG16L1 gene polymorphisms are associated with palmoplantar pustulosis.
21406388 2011 Crohn's disease-associated ATG16L1 polymorphism modulates pro-inflammatory cytokine responses selectively upon activation of NOD2.
21206965 2011 IL23R, NOD2/CARD15, ATG16L1 and PHOX2B polymorphisms in a group of patients with Crohn's disease and correlation with sub-phenotypes.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20875485 2010 Crohn's disease susceptibility gene interactions, a NOD to the newcomer ATG16L1.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20839241 2011 Disease phenotype and genotype are associated with shifts in intestinal-associated microbiota in inflammatory bowel diseases.
20722066 2011 Role of PPARG gene variants in inflammatory bowel disease.
20697744 2010 Age at onset in Huntington's disease is modified by the autophagy pathway: implication of the V471A polymorphism in Atg7.
20639872 2010 Plasma membrane contributes to the formation of pre-autophagosomal structures.
20637199 2010 ATG16L1 and NOD2 interact in an autophagy-dependent antibacterial pathway implicated in Crohn's disease pathogenesis.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20562859 2010 Network organization of the human autophagy system.
20485703 2010 Replication and meta-analysis of 13,000 cases defines the risk for interleukin-23 receptor and autophagy-related 16-like 1 variants in Crohn's disease.
20395867 2010 Is there a role for Crohn's disease-associated autophagy genes ATG16L1 and IRGM in formation of granulomas?
20380008 2010 NOD2/CARD15, ATG16L1 and IL23R gene polymorphisms and childhood-onset of Crohn's disease.
20222171 2010 T300A polymorphism of ATG16L1 and susceptibility to inflammatory bowel diseases: a meta-analysis.
20082483 2010 NOD2, IL23R and ATG16L1 polymorphisms in Lithuanian patients with inflammatory bowel disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20066736 2010 Interaction of the major inflammatory bowel disease susceptibility alleles in Crohn's disease patients.
20024904 2010 Variants at the 3p21 locus influence susceptibility and phenotype both in adults and early-onset patients with inflammatory bowel disease.
20014019 2010 Genome wide association (GWA) predictors of anti-TNFalpha therapeutic responsiveness in pediatric inflammatory bowel disease.
19898471 2010 Nod1 and Nod2 direct autophagy by recruiting ATG16L1 to the plasma membrane at the site of bacterial entry.
19783656 2009 Differential involvement of Atg16L1 in Crohn disease and canonical autophagy: analysis of the organization of the Atg16L1 complex in fibroblasts.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19683022 2009 Lack of association of NKX2-3, IRGM, and ATG16L1 inflammatory bowel disease susceptibility variants with celiac disease.
19659808 2009 Autophagy 16-like 1 rs2241880 G allele is associated with Crohn's disease in German children.
19590455 2009 Association of IL23R p.381Gln and ATG16L1 p.197Ala with Crohn disease in the Czech population.
19575361 2009 Role of ATG16L1 Thr300Ala polymorphism in inflammatory bowel disease: a Study in the Spanish population and a meta-analysis.
19491842 2009 Association of ATG16L1 and IRGM genes polymorphisms with inflammatory bowel disease: a meta-analysis approach.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19337756 2009 ATG16L1 T300A polymorphism and Crohn's disease susceptibility: evidence from 13,022 cases and 17,532 controls.
19334001 2009 Contribution of IL23R but not ATG16L1 to Crohn's disease susceptibility in Koreans.
19276991 Genetic variants in IL-23R and ATG16L1 independently predispose to increased susceptibility to Crohn's disease in a Canadian population.
19269148 2009 Multiple regulatory and effector roles of autophagy in immunity.
19262523 2009 rs224136 on chromosome 10q21.1 and variants in PHOX2B, NCF4, and FAM92B are not major genetic risk factors for susceptibility to Crohn's disease in the German population.
19235913 2009 Association between genetic variants in myosin IXB and Crohn's disease.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19139628 2009 A common role for Atg16L1, Atg5 and Atg7 in small intestinal Paneth cells and Crohn disease.
19120485 2009 Autophagy and pattern recognition receptors in innate immunity.
18985712 2009 Autophagy gene ATG16L1 but not IRGM is associated with Crohn's disease in Canadian children.
18852889 2008 Impaired autophagy of an intracellular pathogen induced by a Crohn's disease associated ATG16L1 variant.
18849966 2008 A key role for autophagy and the autophagy gene Atg16l1 in mouse and human intestinal Paneth cells.
18824555 2009 Molecular prediction of disease risk and severity in a large Dutch Crohn's disease cohort.
18715515 2008 Lack of evidence for association of primary sclerosing cholangitis and primary biliary cirrhosis with risk alleles for Crohn's disease in Polish patients.
18698678 2008 Replication of interleukin 23 receptor and autophagy-related 16-like 1 association in adult- and pediatric-onset inflammatory bowel disease in Italy.
18671817 2008 ATG16L1 T300A shows strong associations with disease subgroups in a large Australian IBD population: further support for significant disease heterogeneity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18521924 2008 Clinical and molecular characteristics of isolated colonic Crohn's disease.
18521914 2008 Contributions of IBD5, IL23R, ATG16L1, and NOD2 to Crohn's disease risk in a population-based case-control study: evidence of gene-gene interactions.
18499543 2008 ATG16L1 and IL23 receptor (IL23R) genes are associated with disease susceptibility in Hungarian CD patients.
18495612 2008 [Correlation of the autophagosome gene ATG16L1 polymorphism and inflammatory bowel disease].
18448665 2008 Golgi-resident small GTPase Rab33B interacts with Atg16L and modulates autophagosome formation.
18438406 2008 Genetic determinants of ulcerative colitis include the ECM1 locus and five loci implicated in Crohn's disease.
18366306 2008 Classification of genetic profiles of Crohn's disease: a focus on the ATG16L1 gene.
18338763 2008 Association of IL23R, TNFRSF1A, and HLA-DRB1*0103 allele variants with inflammatory bowel disease phenotypes in the Finnish population.
18200510 2008 CARD15 and IL23R influences Crohn's disease susceptibility but not disease phenotype in a Brazilian population.
18166373 2008 ATG16L1 Ala197Thr is not associated with susceptibility to Crohn's disease or with phenotype in an Italian population.
18162085 2008 The ATG16L1 gene variants rs2241879 and rs2241880 (T300A) are strongly associated with susceptibility to Crohn's disease in the German population.
18088053 2008 Autophagy gene ATG16L1 influences susceptibility and disease location but not childhood-onset in Crohn's disease in Northern Europe.
18047540 2008 ATG16L1 and IL23R are associated with inflammatory bowel diseases but not with celiac disease in the Netherlands.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17921695 Genome-wide association scanning highlights two autophagy genes, ATG16L1 and IRGM, as being significantly associated with Crohn's disease.
17894849 2007 IL23R R381Q and ATG16L1 T300A are strongly associated with Crohn's disease in a study of New Zealand Caucasians with inflammatory bowel disease.
17625155 2007 Association of the T300A non-synonymous variant of the ATG16L1 gene with susceptibility to paediatric Crohn's disease.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17534574 2007 Association analysis of genetic variants in IL23R, ATG16L1 and 5p13.1 loci with Crohn's disease in Japanese patients.
17484864 2007 A nonsynonymous SNP in ATG16L1 predisposes to ileal Crohn's disease and is independent of CARD15 and IBD5.
17455206 2007 Confirmation of the role of ATG16L1 as a Crohn's disease susceptibility gene.
17435756 2007 Genome-wide association study identifies new susceptibility loci for Crohn disease and implicates autophagy in disease pathogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17200669 2007 A genome-wide association scan of nonsynonymous SNPs identifies a susceptibility variant for Crohn disease in ATG16L1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15620219 2004 Cloning and analysis of human Apg16L.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12665549 2003 Mouse Apg16L, a novel WD-repeat protein, targets to the autophagic isolation membrane with the Apg12-Apg5 conjugate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.