Property Summary

NCBI Gene PubMed Count 33
PubMed Score 172.15
PubTator Score 80.33

Knowledge Summary

Patent (7,802)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 1.2e-05

Protein-protein Interaction (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
743251 screening 1 / 0 / 0 Development of a novel orthosteric Muscarinic 5 (M5) antagonist possessing a hig degree of muscarinic subtype selectivity
743252 screening 1 / 0 / 0 Development of the first CNS penetrant Muscarinic 5 (M5) Positive Allosteric Modulator based on a novel non-isatin core
743435 other 0 / 0 / 0 Development of inhibitors for Dopamine D4 Receptors: Eurofin Panel Assay Results
743437 other 0 / 0 / 0 Development of inhibitors for PLD2 (Eurofin Panel Assay Results)

Gene RIF (22)

PMID Text
26772186 These findings open new perspectives on the roles of ASIC3 in the absence of tissue pH variation, as well as on the contribution of those channels to lipid-mediated signaling.
26033064 This study suggests that ASIC23may play a role as mediators of inflammatory pain and be involved in the pathogenesis of frozen shoulder.
25476599 Blocking ASIC3 in interneurons from temporal lobe epilepsy patients decreased the frequency of action potential firing.
23801332 Sea anemone peptide with uncommon beta-hairpin structure inhibits acid-sensing ion channel 3 (ASIC3) and reveals analgesic activity.
22854960 Lignan from thyme possesses inhibitory effect on ASIC3 channel current.
22842475 Experiments with Asic3 inhibitors show that Asic3 inhibition leads to loss of pressure-induced vasodilation due to pressure detection failure rather than endothelial mechanisms.
22829666 ASIC3 is able to sense the extracellular pH in both directions and to dynamically adapt its activity between pH 5.0 and 8.0, playing a role in fine tuning neuronal membrane potentials and neuron sensitization in various pH environments.
22809504 CAR and ASIC3 co-immunoprecipitate only when co-expressed with PSD-95.
22778854 The highly proton sensitive ASIC3 channels are predominantly distributed in peripheral sensory neurons, correlating with their roles in multimodal sensory perception, including nociception, mechanosensation, and chemosensation.
22702502 A mechanism of induction of ASIC-3 expression relevant to AR was suggested by the finding that eosinophil peroxidase (EPO), acting via ERK1/2, induced the expression of ASIC-3 in epithelial cells.
22157923 The results showed that there was a significant increase in the mean relative optical density of ASIC2 and ASIC3 but not ASIC1a in the lining epithelium and glandular tubes of gastric mucosa in patients with Henoch-Schonlein purpura.
21586569 Atomic level characterization of the nonproton ligand-sensing domain of ASIC3 channels.
21092862 Used coincidentally by sensory neurons to detect lactic acidosis, ASIC3 (amiloride-sensitive cation channel 3) interacts with adenosine triphosphate (ATP) to detect muscle ischemia.
20693874 Neither ASIC3 or ASIC1 knockout influences the development or maintenance of experimental neuropathic pain after nerve injury.
20416288 an independent association between an ASIC3 genetic polymorphism and insulin resistance in Taiwanese
19885742 The biological features of ASIC3 is discussed and recent advances on the role of ASIC3 in the pathogenesis and treatment of arthritis pain, are summarized.
18854755 These results suggest that the ASIC3 may be involved in blood pressure regulation.
18854755 Observational study of gene-disease association. (HuGE Navigator)
17012229 the interaction of ASIC3 and CFTR may contribute to defective salt and fluid transepithelial transport in the cystic fibrotic pulmonary system
15574747 Diclofenac studies show ASIC3 is a significant contributor to cutaneous acid-induced pain.
15317815 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current
12060708 role in modulating high-intensity pain stimuli

AA Sequence

MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERVRYYREF      1 - 70
HHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMP     71 - 140
SPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGL    141 - 210
DIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWG    211 - 280
DCSSASLNPNYEPEPSDPLGSPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNC    281 - 350
AHPAIDAMLRKDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY    351 - 420
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEG    421 - 490
LGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL                                 491 - 531
//

Text Mined References (34)

PMID Year Title
26772186 2016 Non-acidic activation of pain-related Acid-Sensing Ion Channel 3 by lipids.
26033064 2015 Up-regulation of acid-sensing ion channels in the capsule of the joint in frozen shoulder.
25476599 2016 Elevated Expression of Acid-Sensing Ion Channel 3 Inhibits Epilepsy via Activation of Interneurons.
24206072 2013 The potential role of transient receptor potential type A1 as a mechanoreceptor in human periodontal ligament cells.
23801332 2013 Sea anemone peptide with uncommon ?-hairpin structure inhibits acid-sensing ion channel 3 (ASIC3) and reveals analgesic activity.
22854960 2012 Lignan from thyme possesses inhibitory effect on ASIC3 channel current.
22842475 2012 Asic3 is a neuronal mechanosensor for pressure-induced vasodilation that protects against pressure ulcers.
22829666 2012 Human ASIC3 channel dynamically adapts its activity to sense the extracellular pH in both acidic and alkaline directions.
22809504 2012 Coxsackievirus and adenovirus receptor (CAR) mediates trafficking of acid sensing ion channel 3 (ASIC3) via PSD-95.
22778854 2011 ASIC3 channels in multimodal sensory perception.
22702502 2012 Eosinophil peroxidase induces the expression and function of acid-sensing ion channel-3 in allergic rhinitis: in vitro evidence in cultured epithelial cells.
22157923 2012 Expression of acid-sensing ion channels of gastric mucosa from patients with Henoch-Schönlein purpura.
21586569 2011 Atomic level characterization of the nonproton ligand-sensing domain of ASIC3 channels.
21092862 2010 Sensing muscle ischemia: coincident detection of acid and ATP via interplay of two ion channels.
20693874 2010 A role for acid-sensing ion channel 3, but not acid-sensing ion channel 2, in sensing dynamic mechanical stimuli.
20416288 2010 Association between an ASIC3 gene variant and insulin resistance in Taiwanese.
19885742 2010 Acid-sensing ion channels 3: a potential therapeutic target for pain treatment in arthritis.
19812697 2009 Sour ageusia in two individuals implicates ion channels of the ASIC and PKD families in human sour taste perception at the anterior tongue.
18854755 2008 Genetic variation in the ASIC3 gene influences blood pressure levels in Taiwanese.
17012229 2006 Interregulation of proton-gated Na(+) channel 3 and cystic fibrosis transmembrane conductance regulator.
15574747 2004 Acid-induced pain and its modulation in humans.
15471860 2004 Stomatin modulates gating of acid-sensing ion channels.
15317815 2004 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12578970 2003 cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11872753 2002 The multivalent PDZ domain-containing protein CIPP is a partner of acid-sensing ion channel 3 in sensory neurons.
11842212 2002 Functional implications of the localization and activity of acid-sensitive channels in rat peripheral nervous system.
11587714 2001 Selective modulation of heteromeric ASIC proton-gated channels by neuropeptide FF.
10842183 2000 Mammalian ASIC2a and ASIC3 subunits co-assemble into heteromeric proton-gated channels sensitive to Gd3+.
9886053 1999 Molecular cloning and regional distribution of a human proton receptor subunit with biphasic functional properties.
9744806 1998 Identification, functional expression and chromosomal localisation of a sustained human proton-gated cation channel.
9571199 1998 Molecular cloning of a DEG/ENaC sodium channel cDNA from human testis.