Property Summary

NCBI Gene PubMed Count 48
PubMed Score 30.50
PubTator Score 33.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.3e-04
chronic lymphosyte leukemia 1.300 3.9e-04
hereditary spastic paraplegia -1.049 9.1e-03
tuberculosis -1.200 9.1e-03
lung cancer 1.800 1.1e-02
Breast cancer 2.800 3.5e-02
group 3 medulloblastoma 1.200 4.1e-03
primary Sjogren syndrome 1.100 1.1e-02
aldosterone-producing adenoma -1.003 3.4e-02
acute myeloid leukemia -1.400 2.9e-02
ovarian cancer 1.400 6.5e-03

Gene RIF (30)

PMID Text
26945061 These data suggest that CAF-1- and ASF1A-H3-H4-dependent deposition of the histone (H3-H4)2 tetramers is compatible with MMR and protects the discontinuous daughter strand from unnecessary degradation by MMR machinery.
26336826 Data show that the ubiquitin-conjugating enzyme E2 RAD6A/B-MDM2 ubiquitin ligase machinery regulates anti-silencing function 1A protein (ASF1A) degradation.
26186914 quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
25618846 Thermodynamic analysis of the quaternary complex together with structural modeling support that ASF1 and MCM2 could form a chaperoning module for histones H3 and H4 protecting them from promiscuous interactions.
25035411 findings show that ASF1A, a histone-remodeling chaperone specifically enriched in the metaphase II oocyte, is necessary for reprogramming of adult dermal fibroblasts into undifferentiated induced pluripotent stem cell
24700029 The ATR checkpoint pathway causes a histone chaperone normally associated with the replication fork, ASF1a, to degrade through a CRL1(betaTRCP)-dependent ubiquitination/proteasome pathway, leading to the localized dechromatinization and gene repression.
24598821 Data indicate Tousled-like kinases (TLK1) phosphorylation has an impact on cell cycle proteins Asf1a and Asf1b function.
24413054 Co-depletion of the histone chaperones ASF1a and ASF1b in human cells induces all hallmarks of alternative lengthening of telomeres in both primary and cancer cells.
22951827 Asf1a plays a role in regulating IE genes by assembling chromatin onto histone-free viral DNA by 3 h postinfection with herpes simplex virus 1
22407294 The authors propose that Codanin-1 acts as a negative regulator of Asf1 function in chromatin assembly.
22401310 NHRD domain of UBN1 as being an essential region for HIRA interaction and chromatin organization by the HUCA complex
22247756 Low ASF1A is associated with familial longevity.
21807893 Data show that, like HIRA, UBN1, and ASF1a, CABIN1 is involved in heterochromatinization of the genome of senescent human cells.
21347226 HIRA plays a unique, ASF1a-independent role, which is required for the localization of HP1
20800603 Observational study of gene-disease association. (HuGE Navigator)
20227376 Identify marks on histones H3-H4 bound to Asf1 and changes induced upon replication stress.
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
19029251 Hpc2-related domain of UBN1, UBN2, and Hpc2p is an evolutionarily conserved HIRA/Hir-binding domain, which directly interacts with the N-terminal WD repeats of HIRA/Hir.
18971269 IE63 of VZV preferentially bound to ASF1a, and the amino-terminal 30 amino acids of ASF1a were critical for its interaction with IE63.
18378699 ASF1A and ASF1B play a role in the efficiency of nucleosome assembly in vivo in human cells.
18096807 data link Asf1 chaperone function, histone supply, and replicative unwinding of DNA in chromatin; proposed that Asf1, as a histone acceptor and donor, handles parental and new histones at the replication fork via an Asf1-(H3-H4)-MCM2-7 intermediate
17328667 the expression of human ASF1A and ASF1B are upregulated followed by cell proliferation signal, but that of ASF1B is uniquely regulated by transcription factors E2F during cell cycle progression
17293877 the crystal structure, at 2.7 A resolution, of CIA-I in complex with histones H3 and H4
17292837 The structure of the conserved domain of human ASF1A in complex with the C-terminal helix of histone H3 using nuclear magnetic resonance spectroscopy was solved.
17054786 Studies provide evidence for TLK1B-mediated phosphorylation of Asf1 triggering DNA repair.
16980972 The N- and C-terminal regions of ASF1a and ASF1b determine the different affinities of these two proteins for HIRA, by contacting regions outside the HIRA B domain. CAF-1 p60 also uses B domain-like motifs for binding to ASF1a.
15840725 Evidence of binding between a histone and one of its chaperones and genetic data suggesting that this interaction is important in both the DNA damage response and transcriptional silencing.
15664198 Data suggest that Asf1 provides cells with a buffering system for histone excess generated in response to stalled replication and explains how cells maintain an "active" histone pool available during recovery from replication stresses.
15213445 NMR structure of the conserved core of hAsf1 A
11897662 model is proposed in which the synergism between hAsf1 and CAF-1 for nucleosome formation during DNA repair is achieved through a transient physical interaction allowing histone delivery from Asf1 to CAF-1

AA Sequence

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNIL     71 - 140
ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM          141 - 204
//

Text Mined References (61)

PMID Year Title
26945061 2016 DNA Mismatch Repair Interacts with CAF-1- and ASF1A-H3-H4-dependent Histone (H3-H4)2 Tetramer Deposition.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26336826 2015 A conserved RAD6-MDM2 ubiquitin ligase machinery targets histone chaperone ASF1A in tumorigenesis.
26186914 2015 Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2.
25618846 2015 Structural insight into how the human helicase subunit MCM2 may act as a histone chaperone together with ASF1 at the replication fork.
25416956 2014 A proteome-scale map of the human interactome network.
25035411 2014 Cell reprogramming. Histone chaperone ASF1A is required for maintenance of pluripotency and cellular reprogramming.
24700029 2014 ATR checkpoint kinase and CRL1?TRCP collaborate to degrade ASF1a and thus repress genes overlapping with clusters of stalled replication forks.
24616510 2014 Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
24598821 2014 Tousled-like kinases phosphorylate Asf1 to promote histone supply during DNA replication.
24413054 2014 Rapid induction of alternative lengthening of telomeres by depletion of the histone chaperone ASF1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22951827 2012 Chromatin assembly on herpes simplex virus 1 DNA early during a lytic infection is Asf1a dependent.
22407294 2012 Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply.
22401310 2012 Identification of an ubinuclein 1 region required for stability and function of the human HIRA/UBN1/CABIN1/ASF1a histone H3.3 chaperone complex.
22247756 2012 Transcriptional profiling of human familial longevity indicates a role for ASF1A and IL7R.
21807893 2011 Human CABIN1 is a functional member of the human HIRA/UBN1/ASF1a histone H3.3 chaperone complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347226 2011 HP1-mediated formation of alternative lengthening of telomeres-associated PML bodies requires HIRA but not ASF1a.
21269460 2011 Initial characterization of the human central proteome.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20227376 2010 Replication stress interferes with histone recycling and predeposition marking of new histones.
20016786 2009 Phosphorylation-mediated control of histone chaperone ASF1 levels by Tousled-like kinases.
19862764 2009 Analysis of interaction partners of H4 histone by a new proteomics approach.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19029251 2009 Human UBN1 is an ortholog of yeast Hpc2p and has an essential role in the HIRA/ASF1a chromatin-remodeling pathway in senescent cells.
18971269 2009 Varicella-zoster virus immediate-early 63 protein interacts with human antisilencing function 1 protein and alters its ability to bind histones h3.1 and h3.3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18378699 2008 In vivo study of the nucleosome assembly functions of ASF1 histone chaperones in human cells.
18096807 2007 Regulation of replication fork progression through histone supply and demand.
17328667 2007 Transcriptional regulation of human chromatin assembly factor ASF1.
17293877 2007 Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
17292837 2007 Structure of the histone chaperone ASF1 bound to the histone H3 C-terminal helix and functional insights.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17054786 2006 TLK1B promotes repair of UV-damaged DNA through chromatin remodeling by Asf1.
16980972 2006 Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16151251 2005 Functional conservation and specialization among eukaryotic anti-silencing function 1 histone chaperones.
15840725 2005 Structural basis for the interaction of Asf1 with histone H3 and its functional implications.
15664198 2005 Human Asf1 regulates the flow of S phase histones during replicational stress.
15621527 2005 Formation of MacroH2A-containing senescence-associated heterochromatin foci and senescence driven by ASF1a and HIRA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15213445 2004 1H, 13C and 15N resonance assignments of the conserved core of hAsf1 A.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680630 2003 Structure and function of the conserved core of histone deposition protein Asf1.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12842904 2003 Transcription initiation factor IID-interactive histone chaperone CIA-II implicated in mammalian spermatogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093919 2002 Identification and characterization of CIA/ASF1 as an interactor of bromodomains associated with TFIID.
11897662 2002 Human Asf1 and CAF-1 interact and synergize in a repair-coupled nucleosome assembly pathway.
11470414 2001 Identification of human Asf1 chromatin assembly factors as substrates of Tousled-like kinases.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10759893 2000 A human homologue of yeast anti-silencing factor has histone chaperone activity.