Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.19
PubTator Score 11.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.5e-06
malignant mesothelioma 3163 1.5e-05
psoriasis 6685 6.8e-05
nasopharyngeal carcinoma 1056 2.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.700 1.5e-05
psoriasis -1.900 6.8e-05
osteosarcoma -1.889 1.5e-06
nasopharyngeal carcinoma 1.400 2.2e-03

Gene RIF (7)

PMID Text
25654263 Molecular docking yielded a structural model consistent with all of the data that suggested the N-terminal residues of ASB9(1-252) may lie in one CK active site. This model was corroborated by enzymatic activity assays and mutational analysis.
23837592 ASB9 is unstable alone but forms a stable ternary complex with EloBC that binds with high affinity to the Cullin 5 N-terminal domain.
22418839 His103 and Phe107 in hASB9-2 are essential for binding to CKB.
20878058 The results of the present study suggest that ASB9 is a useful prognostic marker for colorectal cancer
20302626 ASB9 interacts with the creatine kinase system and negatively regulates cell growth.
19275750 The purified ASB9-2 protein, the splice variant of ASB9 with only one ankyrin repeat domain, was crystallized and diffracted to 2.2A resolution.
18680464 The splice variant of hASB9, hASB9-2 protein, was cloned, overexpressed, and crystallized and the data showed that the cubic hASB9-2 crystal belongs to space group P4(3)32 with unit-cell parameters.

AA Sequence

MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV      1 - 70
SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE     71 - 140
AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA    141 - 210
SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK    211 - 280
LVLPEDLKQFLLHL                                                            281 - 294
//

Text Mined References (23)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25654263 2015 How the ankyrin and SOCS box protein, ASB9, binds to creatine kinase.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22418839 2012 Crystal structure of Human ASB9-2 and substrate-recognition of CKB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20878058 2010 Clinical significance of ASB9 in human colorectal cancer.
20302626 2010 ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function.
19275750 2009 Crystallization and preliminary X-ray analysis of the splice variant of human ankyrin repeat and suppressor of cytokine signaling box protein 9 (hASB9-2).
19060904 2009 An empirical framework for binary interactome mapping.
18680464 2008 Crystallization and preliminary X-ray analysis of the splice variant of human ankyrin repeat and suppressor of cytokine signaling box protein 9 (hASB9-2).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17148442 2007 Ankyrin repeat and suppressors of cytokine signaling box protein asb-9 targets creatine kinase B for degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.