Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.66
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
pancreatic cancer -1.200 1.4e-04
interstitial lung disease -1.300 1.4e-02
glioblastoma 1.200 3.5e-04
osteosarcoma 1.311 8.0e-03
chronic lymphosyte leukemia 1.400 2.3e-04
group 4 medulloblastoma 1.600 1.1e-03
primitive neuroectodermal tumor 1.200 3.6e-03
juvenile dermatomyositis 1.363 1.8e-09
acute quadriplegic myopathy 1.523 6.4e-06
primary pancreatic ductal adenocarcinoma 1.232 8.6e-03
active Crohn's disease 1.888 1.9e-03
pediatric high grade glioma 1.300 1.3e-03
posterior fossa group A ependymoma 1.100 4.3e-04
pancreatic carcinoma -1.200 1.4e-04
Breast cancer -2.900 4.9e-30
ulcerative colitis 1.300 9.1e-04
ovarian cancer -1.300 1.2e-02

Pathway (1)

Gene RIF (12)

PMID Text
26490116 We found that ARRDC3 is required for ALIX ubiquitination induced by activation of PAR1
25220262 The ARRDC3 is one of six known human alpha-arrestins, and has been implicated in the downregulation of the beta2-adrenergic receptor (beta2AR).
25148870 Promoter hypermethylation is an important mechanism of the transcriptional inactivation of ARRDC3 in invasive ductal breast carcinoma.
24379409 High affinity binding of full-length ARRDC3 and Nedd4 is driven by the avid interaction of both PPXY motifs with either the WW2-WW3 or WW3-WW4 combinations.
23208550 Beta 2 adrenergic receptor endocytosis requires beta-arrestin2 but not ARRDC3.
21982743 The obesity risk locus contains a single gene, arrestin domain-containing 3 (ARRDC3), which interacts directly with beta-adrenergic receptors and is gender-specific.
21652578 single-nucleotide polymorphisms in ARRDC3, FLT1, and SKAP1 were significant predictors for survival androgen-deprivation therapy in prostate cancer patients.
20603614 ARRDC3 directly binds to a phosphorylated form of ITGbeta4 leading to its internalization, ubiquitination and ultimate degradation, and suppress breast cancer progression.
20559325 Data show that ARRDC3 interacts with NEDD4 through two conserved PPXY motifs and recruits NEDD4 to the activated beta2-adrenergic receptor.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19605364 Txnip regulates cellular metabolism independent of its binding to thioredoxin and the arrestin domains are crucial structural elements in metabolic functions of alpha-arrestin proteins
16269462 [Thioredoxin-binding protein-2-like inducible membrane protein, TLIMP] TLIMP, a novel VD3- or PPARgamma ligand-inducible membrane-associated protein, plays a regulatory role in cell proliferation and PPARgamma activation.

AA Sequence

MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTA      1 - 70
YTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKA     71 - 140
ELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQI    141 - 210
FAEIENCSSRMVVPKAAIYQTQAFYAKGKMKEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDC    211 - 280
SIIRVEYSLMVYVDIPGAMDLFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYA    281 - 350
EVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR          351 - 414
//

Text Mined References (23)

PMID Year Title
26490116 2015 The ?-arrestin ARRDC3 mediates ALIX ubiquitination and G protein-coupled receptor lysosomal sorting.
25416956 2014 A proteome-scale map of the human interactome network.
25220262 2014 Insights into ?2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3.
25148870 2014 Promoter hypermethylation may be an important mechanism of the transcriptional inactivation of ARRDC3, GATA5, and ELP3 in invasive ductal breast carcinoma.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24379409 2014 Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).
23319801 2013 Identification of inherited genetic variations influencing prognosis in early-onset breast cancer.
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
23208550 2013 Distinct roles for ?-arrestin2 and arrestin-domain-containing proteins in ?2 adrenergic receptor trafficking.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21982743 2011 The arrestin domain-containing 3 protein regulates body mass and energy expenditure.
21652578 2012 Genetic polymorphisms in androgen receptor-binding sites predict survival in prostate cancer patients receiving androgen-deprivation therapy.
20603614 2010 ARRDC3 suppresses breast cancer progression by negatively regulating integrin beta4.
20559325 2010 Arrestin domain-containing protein 3 recruits the NEDD4 E3 ligase to mediate ubiquitination of the beta2-adrenergic receptor.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
19605364 2009 Thioredoxin-independent regulation of metabolism by the alpha-arrestin proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269462 2006 Thioredoxin-binding protein-2-like inducible membrane protein is a novel vitamin D3 and peroxisome proliferator-activated receptor (PPAR)gamma ligand target protein that regulates PPARgamma signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.