Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.00
PubTator Score 0.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 MGI Phenotype (1)

AA Sequence

MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKN      1 - 70
QAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGL     71 - 140
GSIIRVLTARKTV                                                             141 - 153
//

Text Mined References (20)

PMID Year Title