Property Summary

NCBI Gene PubMed Count 22
PubMed Score 40.73
PubTator Score 9.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
Astrocytoma, Pilocytic -1.100 3.4e-04
breast carcinoma 1.300 4.4e-06
glioblastoma -1.200 8.1e-04
group 4 medulloblastoma -1.400 9.1e-04
lung cancer 1.200 3.0e-02
malignant mesothelioma -1.400 5.5e-07
medulloblastoma, large-cell -1.600 3.4e-03
ovarian cancer -1.800 1.3e-12
psoriasis -1.300 6.9e-03

Gene RIF (4)

AA Sequence

MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGD      1 - 70
QKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALS     71 - 140
QTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEIL    141 - 210
QQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ    211 - 280
SLAHSVDFTRPGTASTMLRASLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPG    281 - 350
EQRETVLQAYISNDLLDCYSHNQRSVLQLLHSTSDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLEG    351 - 420
RLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRS    421 - 490
TGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMI    491 - 560
RQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTN    561 - 630
TGKTRRKGLANVQWSGDEPLQRPVTPGGHRNGYPVVEDQHTPPQTAQHARNGHPQALPAAHEAVYREGKP    631 - 700
STPESCVSSSSAIIAKPGEWLPRGRQEEPRPAPTTPRQPREAPQDPGNGVTTRECASAFTCKPRAPCTPE    701 - 770
MLDWNPPKAKASVLAPLFSSCGPQQASRPGSTASSTRGLPSSQSHRK                           771 - 817
//

Text Mined References (25)

PMID Year Title