Property Summary

NCBI Gene PubMed Count 9
PubMed Score 38.04
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 7.8e-08
acute quadriplegic myopathy 1158 1.3e-07
lung cancer 4740 5.9e-05
osteosarcoma 7950 3.9e-03
Disease Target Count Z-score Confidence
Plague 19 4.435 2.2
Cholera 34 3.127 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.566 1.3e-07
lung adenocarcinoma 1.424 7.8e-08
lung cancer 1.600 5.9e-05
osteosarcoma 1.109 3.9e-03

Gene RIF (2)

AA Sequence

MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECR      1 - 70
ANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNK     71 - 140
RAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQ    141 - 210
VVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF    211 - 280
YW                                                                        281 - 282
//

Text Mined References (18)

PMID Year Title