Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.43
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q6T311
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
18976975 Knockdown of ADP-ribosylation factor-like 9 (ARL9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEI      1 - 70
GGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIH     71 - 140
EALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ                           141 - 187
//

Text Mined References (3)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.