Property Summary

NCBI Gene PubMed Count 7
PubMed Score 18.76
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.039 1.7e-02
oligodendroglioma -1.100 4.7e-02
psoriasis 2.500 1.3e-05
osteosarcoma 3.261 2.8e-10
atypical teratoid / rhabdoid tumor -1.300 3.3e-03
medulloblastoma, large-cell -1.500 1.4e-06
Atopic dermatitis -1.200 3.0e-03
pancreatic ductal adenocarcinoma liver m... -1.373 3.5e-02
tuberculosis and treatment for 6 months 1.400 9.4e-05
intraductal papillary-mucinous adenoma (... 1.300 4.5e-02
intraductal papillary-mucinous carcinoma... 1.400 4.3e-02
Breast cancer 2.600 4.6e-02
Pick disease 1.500 1.5e-06
ovarian cancer -2.000 2.9e-07

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
25496667 Genome-wide shRNA screening identifies ARL5A, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24327274 microRNA-202-3p inhibits cell proliferation by targeting ADP-ribosylation factor-like 5A in human colorectal carcinoma.
15896705 crystal structure
12414990 developmentally regulated ARL5, with its distinctive nuclear/nucleolar localization and interaction with HP1alpha, may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development

AA Sequence

MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ      1 - 70
ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ     71 - 140
FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR                                   141 - 179
//

Text Mined References (9)

PMID Year Title
24327274 2014 microRNA-202-3p inhibits cell proliferation by targeting ADP-ribosylation factor-like 5A in human colorectal carcinoma.
15896705 2005 2.0 A crystal structure of human ARL5-GDP3'P, a novel member of the small GTP-binding proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450215 2002 Identification and characterization of nine novel human small GTPases showing variable expressions in liver cancer tissues.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.