Property Summary

NCBI Gene PubMed Count 40
PubMed Score 37.70
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.071 7.1e-03
adult high grade glioma -1.600 3.9e-06
glioblastoma -1.400 1.1e-07
lung cancer -1.100 7.2e-03
medulloblastoma, large-cell -1.200 8.5e-04
Multiple myeloma 1.166 1.8e-02
ovarian cancer -1.100 3.2e-03
subependymal giant cell astrocytoma -1.023 2.2e-02

Gene RIF (13)

AA Sequence

MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGG      1 - 70
QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIA     71 - 140
EGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK                                141 - 182
//

Text Mined References (47)

PMID Year Title