Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary


No data available



  Differential Expression (5)

Disease log2 FC p
gastric cancer 1.100 2.0e-03
intraductal papillary-mucinous carcinoma... -1.300 2.5e-02
group 3 medulloblastoma 1.500 2.9e-03
Breast cancer -1.200 2.5e-05
ovarian cancer -1.200 4.6e-04


Accession Q8N8L6
Symbols ARL10A


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

REVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS                                        211 - 244

Text Mined References (3)

PMID Year Title
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.