Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.200 2.5e-05
gastric cancer 1.100 2.0e-03
group 3 medulloblastoma 1.500 2.9e-03
intraductal papillary-mucinous carcinoma... -1.300 2.5e-02
ovarian cancer -1.200 4.6e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEP      1 - 70
ALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWK     71 - 140
EFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQ    141 - 210
REVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS                                        211 - 244
//

Text Mined References (3)

PMID Year Title