Property Summary

NCBI Gene PubMed Count 28
PubMed Score 3.54
PubTator Score 27.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.369 1.1e-02
astrocytic glioma -1.200 2.1e-02
dermatomyositis 1.100 2.2e-04
glioblastoma 1.100 6.8e-03
hereditary spastic paraplegia -1.090 7.0e-03
invasive ductal carcinoma 1.100 1.1e-03
medulloblastoma -1.100 4.9e-04
medulloblastoma, large-cell -1.600 6.8e-04
osteosarcoma 1.156 3.4e-02
ovarian cancer -1.400 2.7e-05
pancreatic ductal adenocarcinoma liver m... -1.339 1.4e-02

Gene RIF (10)

AA Sequence

MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG      1 - 70
QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA     71 - 140
NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ                                 141 - 181
//

Text Mined References (33)

PMID Year Title