Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.46
PubTator Score 15.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.500 8.6e-07
astrocytoma 2.900 2.7e-04
ependymoma 1.400 4.4e-02
oligodendroglioma 2.000 3.6e-03
psoriasis -1.800 2.1e-08
glioblastoma 2.000 5.5e-06
osteosarcoma -1.660 8.0e-05
atypical teratoid / rhabdoid tumor 1.100 2.1e-04
medulloblastoma, large-cell -1.300 2.2e-05
primitive neuroectodermal tumor 1.300 1.7e-03
tuberculosis and treatment for 6 months 1.600 2.0e-04
intraductal papillary-mucinous adenoma (... 1.300 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.6e-03
lung cancer -1.700 4.4e-03
breast carcinoma -1.400 3.4e-29
cystic fibrosis -1.300 4.2e-04
pediatric high grade glioma 1.500 6.5e-07
group 3 medulloblastoma 1.500 9.9e-03
pilocytic astrocytoma 1.400 2.3e-06
aldosterone-producing adenoma -1.012 4.4e-02
lung adenocarcinoma -1.200 1.4e-06
non-inflammatory breast cancer -1.300 2.7e-02
ductal carcinoma in situ -1.500 1.2e-03
invasive ductal carcinoma -2.100 9.4e-04
ovarian cancer 1.700 2.3e-05
dermatomyositis 1.400 8.0e-04

Gene RIF (1)

PMID Text
16143467 Solo mRNA is ubiquitously expressed but enriched in brain, and it undergoes extensive alternative splicing.

AA Sequence

MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLAKVQQEACAQY      1 - 70
SGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLALKCLAPGGGRVQEVPVPNEA     71 - 140
CAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAELICPRFVHKEGLMVGHQPSTLPPELPSGPP    141 - 210
GLPSPPLPEEALGTRSPGDGHNAPVEGPEGEYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGK    211 - 280
GRHRRHRAWMHQKGLGPRGQDGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAEAVGEASGSCPL    281 - 350
RPGELRGGGGGGQGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPGDKEDASHQEALGNLPSP    351 - 420
SEHKLPECHLVKEEYEGSGKPESEPKELKTAGEKEPQLSEACGPTEEGAGERELEGPGLLCMAGHTGPEG    421 - 490
PLSDTPTPPLETVQEGKGDNIPEEALAVSVSDHPDVAWDLMASGFLILTGGVDQSGRALLTITPPCPPEE    491 - 560
PPPSRDTLNTTLHYLHSLLRPDLQTLGLSVLLDLRQAPPLPPALIPALSQLQDSGDPPLVQRLLILIHDD    561 - 630
LPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEE    631 - 700
LEGAAEPEEEEAVGMPKPLQKVLADPRLTALQRDGGAILMRLRSTPSSKLEGQGPATLYQEVDEAIHQLV    701 - 770
RLSNLHVQQQEQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARE    771 - 840
ALALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGREAVLAALALRR    841 - 910
APEPSAGTFQEMRALALDLGSPAALREWGRCQARCQELERRIQQHVGEEASPRGYRRRRADGASSGGAQW    911 - 980
GPRSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEGPELAPEAEGRPPRAVLIRGLEVTSTEVVDR    981 - 1050
TCSPREHVLLGRARGPDGPWGVGTPRMERKRSISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELR   1051 - 1120
GTWAAALSARERLRSFHRTHFLRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLS   1121 - 1190
KGSMEAGPYLPRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAAVQLLREQEARGRDLLAVEAVR   1191 - 1260
GCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFKTADMGLTENI   1261 - 1330
GDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKELRVQQMVSMGIGNKPFLDIK   1331 - 1400
ALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGACSLPARVEEEAWDLDVKQISLAPETLDSS   1401 - 1470
GDVSPGPRNSPSLQPPHPGSSTPTLASRGILGLSRQSHARALSDPTTPL                        1471 - 1519
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16143467 2005 Identification, expression analysis, genomic organization and cellular location of a novel protein with a RhoGEF domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.