Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.26
PubTator Score 8.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.700 1.1e-07
oligodendroglioma 2.200 8.2e-03
cutaneous lupus erythematosus -1.600 4.7e-05
psoriasis -2.000 3.4e-05
astrocytoma 1.400 2.7e-19
glioblastoma multiforme 1.200 1.4e-13
posterior fossa group B ependymoma 1.600 1.7e-08
medulloblastoma, large-cell -3.500 1.0e-06
Atopic dermatitis -1.600 1.3e-04
pancreatic ductal adenocarcinoma liver m... -2.507 6.1e-04
non-small cell lung cancer -2.051 1.8e-16
intraductal papillary-mucinous adenoma (... -1.500 4.5e-03
intraductal papillary-mucinous neoplasm ... -2.600 1.7e-03
lung cancer -1.900 1.1e-04
colon cancer -1.200 1.5e-02
Breast cancer 2.600 3.8e-02
lung adenocarcinoma -2.400 3.3e-22
pediatric high grade glioma 1.200 1.0e-03
group 4 medulloblastoma -1.700 2.2e-05
pilocytic astrocytoma 1.600 1.3e-04
lung carcinoma -1.500 1.9e-13
ovarian cancer -1.900 3.8e-12
pituitary cancer -1.600 2.8e-03
chronic rhinosinusitis -1.294 2.8e-03

 GWAS Trait (1)

Gene RIF (6)

PMID Text
24399467 A novel function of SGEF that excludes GEF.
23775076 Data indicate that the Src homology 3 domain-containing GEF (SGEF) promotes fibroblast growth factor-inducible 14 (Fn14) proinvasive signaling in glioblastoma via TNF receptor-associated factor 2 (TRAF2).
23661635 We report for the first time an SGEF function for RhoG that excludes GEF and the ability of SGEF to enhance EGFR stability and signaling by delaying its lysosomal sorting and degradation
22824926 SGEF is a novel promoter of human prostate cancer progression and development.
22383878 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
12697679 SGEF gene on chromosome 3q25.2. CSGEF expression controlled by androgen-responsive promoter of SGEF gene. SGEF may be regulator of Rho guanosine triphosphatases. CSGEF may function as regulator of Rho guanosine triphosphatase in prostate

AA Sequence

MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLLAAQIPAQVPT      1 - 70
ASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVPGGSPKSPANGAVTLPAPPP     71 - 140
PPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSS    141 - 210
SEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRS    211 - 280
MVEGLGGPLGHAGEESEVDNDVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMED    281 - 350
KEKFSSLGRIKKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ    351 - 420
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHHLFSNITDV    421 - 490
CEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRI    491 - 560
ESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERT    561 - 630
EMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEES    631 - 700
YNVNDYSLRDQLLVESCDNEELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSER    701 - 770
ARWITALGHSSGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF    771 - 840
PMECAKEITCQATIDKNVERMGRLLGLETNV                                           841 - 871
//

Text Mined References (20)

PMID Year Title
24399467 2014 Grb2 interacts with SGEF and antagonizes the ability of SGEF to enhance EGF-induced ERK1/2 activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775076 2013 The Src homology 3 domain-containing guanine nucleotide exchange factor is overexpressed in high-grade gliomas and promotes tumor necrosis factor-like weak inducer of apoptosis-fibroblast growth factor-inducible 14-induced cell migration and invasion via tumor necrosis factor receptor-associated factor 2.
23661635 2013 SGEF enhances EGFR stability through delayed EGFR trafficking from early to late endosomes.
22824926 2012 SGEF is overexpressed in prostate cancer and contributes to prostate cancer progression.
22383878 2012 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21332407 2011 Comparative proteomic analysis of advanced serous epithelial ovarian carcinoma: possible predictors of chemoresistant disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17875742 2007 RhoG regulates endothelial apical cup assembly downstream from ICAM1 engagement and is involved in leukocyte trans-endothelial migration.
17074883 2006 Differential activation and function of Rho GTPases during Salmonella-host cell interactions.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15133129 2004 SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12697679 2003 Isolation of the novel human guanine nucleotide exchange factor Src homology 3 domain-containing guanine nucleotide exchange factor (SGEF) and of C-terminal SGEF, an N-terminally truncated form of SGEF, the expression of which is regulated by androgen in prostate cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.