Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.73
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
group 3 medulloblastoma 2254 3.4e-03
Disease Target Count Z-score Confidence
Mucosal melanoma 2 3.72 1.9
Rectum adenocarcinoma 5 3.23 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.4e-03

Synonym

Accession Q96PE2 B2RP20 Q86XU2 Q8N2S0 Q9Y4G3
Symbols TEM4
RHOGEF17
P164RHOGEF
p164-RhoGEF

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (6)

PMID Text
26953350 Interaction of the central domain of ARHGEF17 with Mps1.
23195829 The rho guanine nucleotide exchange factor 17 is drastically alter the effect of cGMP/cGK involving signaling pathways on RhoA-activated downstream effectors.
22911862 TEM4 contains a novel actin binding domain and binding to actin is essential for TEM4 subcellular localization and activity.
19911011 Observational study of gene-disease association. (HuGE Navigator)
18677770 Identification of ARHGEF17, mutations in melanoma.
12071859 a Rho-specific GEF with novel structural and regulatory properties and predominant expression in the heart

AA Sequence

MADGAPRPQLYRSVSFKLLERWSGGPGLREEDTDTPGLRRRASCRPTTAARGQPSRRVSKLASGPLAAPA      1 - 70
QPRPLRSLSPSVRQLSRRFDAPRLDDGSAGTRDGGVLPAAAEEAAEGPARGAWPSVTEMRKLFGGPGSRR     71 - 140
PSADSESPGTPSPDGAAWEPPARESRQPPTPPPRTCFPLAGLRSARPLTGPETEGRLRRPQQQQERAQRP    141 - 210
ADGLHSWHIFSQPQAGARASCSSSSIAASYPVSRSRAASSSEEEEEGPPQLPGAQSPAYHGGHSSGSDDD    211 - 280
RDGEGGHRWGGRPGLRPGSSLLDQDCRPDSDGLNLSSMNSAGVSGSPEPPTSPRAPREEGLREWGSGSPP    281 - 350
CVPGPQEGLRPMSDSVGGAFRVAKVSFPSYLASPAGSRGSSRYSSTETLKDDDLWSSRGSGGWGVYRSPS    351 - 420
FGAGEGLLRSQARTRAKGPGGTSRALRDGGFEPEKSRQRKSLSNPDIASETLTLLSFLRSDLSELRVRKP    421 - 490
GGSSGDRGSNPLDGRDSPSAGGPVGQLEPIPIPAPASPGTRPTLKDLTATLRRAKSFTCSEKPMARRLPR    491 - 560
TSALKSSSSELLLTGPGAEEDPLPLIVQDQYVQEARQVFEKIQRMGAQQDDGSDAPPGSPDWAGDVTRGQ    561 - 630
RSQEELSGPESSLTDEGIGADPEPPVAAFCGLGTTGMWRPLSSSSAQTNHHGPGTEDSLGGWALVSPETP    631 - 700
PTPGALRRRRKVPPSGSGGSELSNGEAGEAYRSLSDPIPQRHRAATSEEPTGFSVDSNLLGSLSPKTGLP    701 - 770
ATSAMDEGLTSGHSDWSVGSEESKGYQEVIQSIVQGPGTLGRVVDDRIAGKAPKKKSLSDPSRRGELAGP    771 - 840
GFEGPGGEPIREVEPMLPPSSSEPILVEQRAEPEEPGATRSRAQSERALPEALPPPATAHRNFHLDPKLA    841 - 910
DILSPRLIRRGSKKRPARSSHQELRRDEGSQDQTGSLSRARPSSRHVRHASVPATFMPIVVPEPPTSVGP    911 - 980
PVAVPEPIGFPTRAHPTLQAPSLEDVTKQYMLNLHSGEVPAPVPVDMPCLPLAAPPSAEAKPPEAARPAD    981 - 1050
EPTPASKCCSKPQVDMRKHVAMTLLDTEQSYVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPEL   1051 - 1120
LEHHEQFLEQVRHCMQTWHAQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLE   1121 - 1190
QSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEE   1191 - 1260
AERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAIGGKKDRSLFLFTDLIVCTTLKRKSGSLRRS   1261 - 1330
SMSLYTAASVIDTASKYKMLWKLPLEDADIIKGASQATNRENIQKAISRLDEDLTTLGQMSKLSESLGFP   1331 - 1400
HQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELCATRPEGTDSYIFEFPHPDARLGFEQAFDEAK   1401 - 1470
RKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVE   1471 - 1540
ACIAVCSARILCIGAVPGLQPRCHREPPPSLRSPPETAPEPAGPELDVEAAADEEAATLAEPGPQPCLHI   1541 - 1610
SIAGSGLEMTPGLGEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETT   1611 - 1680
SSEEEQEPGFLPLSGSFGPGGPCGTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCV   1681 - 1750
HVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKSVTLGTQGSP   1751 - 1820
ITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHMFYVGQDSSRCVACMVDSSLGVWVTLKGSAHVCLYHPDT   1821 - 1890
FEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPL   1891 - 1960
SPTGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPWHRGPAPARPKMLVISGG   1961 - 2030
DGYEDFRLSSGGGSSSETVGRDDSTNHLLLWRV                                        2031 - 2063
//

Text Mined References (21)

PMID Year Title
26953350 2016 ARHGEF17 is an essential spindle assembly checkpoint factor that targets Mps1 to kinetochores.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23195829 2013 RhoGEF17, a Rho-specific guanine nucleotide exchange factor activated by phosphorylation via cyclic GMP-dependent kinase I?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911862 2012 Identification of a novel actin-binding domain within the Rho guanine nucleotide exchange factor TEM4.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
18677770 2008 Identification of ARHGEF17, DENND2D, FGFR3, and RB1 mutations in melanoma by inhibition of nonsense-mediated mRNA decay.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12071859 2002 A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11559528 2001 Cell surface tumor endothelial markers are conserved in mice and humans.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.