Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.97
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
primary Sjogren syndrome -1.500 3.3e-03
ductal carcinoma in situ 2.000 2.4e-03
invasive ductal carcinoma 2.100 4.1e-03

Gene RIF (9)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20179103 Pin1 regulates BPGAP1 function in Rho and Erk signalling, with active Mek2 serving as a novel regulatory scaffold that promotes crosstalk between RhoGAP, Pin1 and Erk in the regulation of cell migration.
19913121 Observational study of gene-disease association. (HuGE Navigator)
15944398 findings reveal a concomitant activation of endocytosis and ERK signaling by BPGAP1 via the coupling of its proline-rich region, which targets EEN and its functional GAP domain
15506981 BPGAP1 is a novel RhoGAP that co-ordinately regulates pseudopodia and cell migration through the interplay of its BNIP-2 and Cdc42GAP homology domains.
15225876 ARHGAP8 expression was up-regulated in the majority of primary colorectal tumors analyzed in this work.
15064355 RhoGAP functionally interacts with cortactin and represents a novel determinant in the regulation of cell dynamics.
12944407 BPGAP1 has a role in regulating cell dynamics with BNIP-2 and Cdc42GAP homology/Sec14p-like, proline-rich, and GTPase-activating protein domains of BPGAP1
12559566 This paper compares the protein sequences and genomic structures of human and mouse ARHGAP8.

AA Sequence

MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDY      1 - 70
TIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALY     71 - 140
VVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPT    141 - 210
KTPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQ    211 - 280
GKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLR    281 - 350
YLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE    351 - 420
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL                              421 - 464
//

Text Mined References (20)

PMID Year Title
24882193 2014 Bipolar disorder with comorbid binge eating history: a genome-wide association study implicates APOB.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22554406 2012 Family-based genome-wide association study of frontal ? oscillations identifies potassium channel gene KCNJ6.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20179103 2010 Active Mek2 as a regulatory scaffold that promotes Pin1 binding to BPGAP1 to suppress BPGAP1-induced acute Erk activation and cell migration.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18217980 Microarray analysis of normal cervix, carcinoma in situ, and invasive cervical cancer: identification of candidate genes in pathogenesis of invasion in cervical cancer.
16555160 2006 [Refined deletion mapping of loss of heterozygosity on 22q13 in sporadic colorectal carcinoma].
15955831 2005 Transcriptional profiling of human hematopoiesis during in vitro lineage-specific differentiation.
15944398 2005 Activation of EGF receptor endocytosis and ERK1/2 signaling by BPGAP1 requires direct interaction with EEN/endophilin II and a functional RhoGAP domain.
15506981 2004 Filling the GAPs in cell dynamics control: BPGAP1 promotes cortactin translocation to the cell periphery for enhanced cell migration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225876 2004 ARHGAP8 is a novel member of the RHOGAP family related to ARHGAP1/CDC42GAP/p50RHOGAP: mutation and expression analyses in colorectal and breast cancers.
15064355 2004 BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12944407 2003 Concerted regulation of cell dynamics by BNIP-2 and Cdc42GAP homology/Sec14p-like, proline-rich, and GTPase-activating protein domains of a novel Rho GTPase-activating protein, BPGAP1.
12559566 2003 Identification and characterization of a gene encoding a putative mouse Rho GTPase activating protein gene 8, Arhgap8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297274 2002 Human RhoGAP domain-containing proteins: structure, function and evolutionary relationships.
10591208 1999 The DNA sequence of human chromosome 22.