Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.59
PubTator Score 2.59

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.400 2.8e-04
astrocytoma 1.100 1.9e-15
Astrocytoma, Pilocytic 1.800 1.1e-07
cystic fibrosis -1.007 1.9e-03
ependymoma 1.100 3.0e-04
glioblastoma 1.700 3.0e-07
group 3 medulloblastoma 2.300 3.4e-05
head and neck cancer -1.100 2.1e-02
intraductal papillary-mucinous adenoma (... 2.000 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.900 1.6e-03
invasive ductal carcinoma -1.300 4.6e-03
oligodendroglioma 1.200 4.4e-13
pancreatic cancer 1.300 3.8e-04
subependymal giant cell astrocytoma 1.737 1.9e-02
ulcerative colitis -1.300 6.3e-05


Accession A6NI28 Q96M56
Symbols AD031


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL                                        841 - 874

Text Mined References (16)

PMID Year Title