Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.97
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.200 3.6e-03
Astrocytoma, Pilocytic 1.600 3.0e-07
cutaneous lupus erythematosus 1.600 3.4e-03
glioblastoma 1.400 1.5e-02
group 3 medulloblastoma 1.100 1.6e-02
interstitial cystitis 1.900 3.9e-04
intraductal papillary-mucinous carcinoma... -1.500 1.0e-02
intraductal papillary-mucinous neoplasm ... -1.600 2.8e-02
invasive ductal carcinoma 1.259 1.4e-03
lung cancer -1.300 9.6e-03
lung carcinoma -1.900 3.4e-20
non-small cell lung cancer -1.563 4.5e-13
oligodendroglioma -1.300 1.3e-02
osteosarcoma -1.882 5.7e-08
primary Sjogren syndrome 2.200 2.8e-04
subependymal giant cell astrocytoma 2.035 2.6e-02
ulcerative colitis 1.800 5.3e-05
Waldenstrons macroglobulinemia 1.781 6.3e-04

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHRRNHSQHILKD      1 - 70
VIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLC     71 - 140
GAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRS    141 - 210
SSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFG    211 - 280
SHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHV    281 - 350
VTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA    351 - 420
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED                   421 - 475
//

Text Mined References (21)

PMID Year Title