Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q3KRB8
Symbols B'-T
FAM7B1
GAP (1-8)

  Ortholog (1)

Species Source Disease
Inparanoid OMA

Gene RIF (1)

AA Sequence

MWDQRLVKLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVPEYGHIPSFLV      1 - 70
DACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGLLKQFFRELPEPILPADLHEA     71 - 140
LLKAQQLGTEEKNKAILLLSCLLADHTVHVLRYFFNFLRNVSLRSSENKMDSSNLAVIFAPNLLQTSEGH    141 - 210
EKMSSNAEKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV                 211 - 267
//

Text Mined References (7)

PMID Year Title