Property Summary

NCBI Gene PubMed Count 67
PubMed Score 275.18
PubTator Score 159.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.278 2.9e-02
adult high grade glioma -1.400 1.3e-02
astrocytic glioma -1.900 2.0e-02
atypical teratoid / rhabdoid tumor -1.100 1.2e-04
Endometriosis -2.175 1.2e-02
ependymoma -2.100 3.0e-02
esophageal adenocarcinoma -1.500 3.1e-02
glioblastoma -1.300 1.9e-04
hereditary spastic paraplegia 1.286 1.8e-02
interstitial cystitis -1.800 2.1e-04
juvenile dermatomyositis 2.370 4.2e-07
lung adenocarcinoma 1.159 1.9e-02
lung cancer 1.600 1.4e-02
lung carcinoma 2.000 6.8e-17
medulloblastoma -1.200 1.0e-02
medulloblastoma, large-cell -1.200 1.1e-04
nephrosclerosis -1.514 4.2e-02
non-small cell lung cancer 1.452 6.5e-08
oligodendroglioma -2.100 1.5e-02
osteosarcoma -1.562 2.1e-06
pancreatic cancer 1.200 4.0e-04
pancreatic carcinoma 1.200 4.0e-04
pituitary cancer -1.400 2.2e-04
psoriasis -1.200 6.9e-03
tuberculosis and treatment for 6 months -1.100 3.6e-03

Gene RIF (61)

AA Sequence

MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD      1 - 70
LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV     71 - 140
WVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILK    141 - 210
NYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA    211 - 280
EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQA    281 - 350
RVRI                                                                      351 - 354
//

Text Mined References (71)

PMID Year Title