Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.76
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (2)

AA Sequence

MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSP      1 - 70
APPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTR     71 - 140
QIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLEL    141 - 210
HEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLG    211 - 280
PRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQ    281 - 350
TLKQFHIKLKTPGVDAPSWLEEQ                                                   351 - 373
//

Text Mined References (23)

PMID Year Title