Property Summary

NCBI Gene PubMed Count 27
PubMed Score 5.57
PubTator Score 11.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.500 3.2e-03
Astrocytoma, Pilocytic 1.100 1.8e-04
atypical teratoid / rhabdoid tumor 1.300 2.2e-04
chronic rhinosinusitis -1.331 2.2e-02
ependymoma 1.300 2.4e-02
glioblastoma 1.800 4.0e-06
group 4 medulloblastoma 1.300 2.3e-04
oligodendroglioma 1.700 9.4e-04
ovarian cancer -1.300 2.7e-04
pediatric high grade glioma 1.200 4.2e-05
Rheumatoid arthritis -1.100 3.5e-02
ulcerative colitis -1.600 1.2e-07

Gene RIF (14)

AA Sequence

MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEK      1 - 70
QNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEH     71 - 140
DLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINF    141 - 210
FKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQK    211 - 280
AGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGK    281 - 350
SGIILQAESRKENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNS    351 - 420
EMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDESFPEAEDSLL    421 - 490
QQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQSLRLIDPQTQVSRANFEL    491 - 560
TSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALAQLML    561 - 630
SIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA                                        631 - 664
//

Text Mined References (29)

PMID Year Title