Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
pituitary cancer 1972 2.3e-07
posterior fossa group A ependymoma 468 1.1e-03
adult high grade glioma 3801 3.7e-03
medulloblastoma 720 1.2e-02
Endometriosis 540 1.7e-02
osteosarcoma 7950 2.1e-02

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.300 3.7e-03
Endometriosis -1.289 1.7e-02
medulloblastoma 1.500 1.2e-02
osteosarcoma 1.176 2.1e-02
pituitary cancer -2.800 2.3e-07
posterior fossa group A ependymoma 1.200 1.1e-03

Gene RIF (4)

AA Sequence

MEGAALLKIFVVCIWVQQNHPGWTVAGQFQEKKRFTEEVIEYFQKKVSPVHLKILLTSDEAWKRFVRVAE      1 - 70
LPREEADALYEALKNLTPYVAIEDKDMQQKEQQFREWFLKEFPQIRWKIQESIERLRVIANEIEKVHRGC     71 - 140
VIANVVSGSTGILSVIGVMLAPFTAGLSLSITAAGVGLGIASATAGIASSIVENTYTRSAELTASRLTAT    141 - 210
STDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGRPLIAWRYVPINVVETLRTRGA    211 - 280
PTRIVRKVARNLGKATSGVLVVLDVVNLVQDSLDLHKGAKSESAESLRQWAQELEENLNELTHIHQSLKA    281 - 350
G//

Text Mined References (10)

PMID Year Title