Property Summary

NCBI Gene PubMed Count 80
PubMed Score 275.12
PubTator Score 221.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Protein-protein Interaction (5)

Gene RIF (53)

PMID Text
26829325 apoD protein levels are variable across different brain regions.
26083030 hepatic steatosis observed in apoD Tg mice is a consequence of increased PPARgamma transcriptional activity by AA leading to increased fatty acid uptake by the liver
25953740 The data suggest that the presence of Apo D in the nucleus, which some authors related with a specific transport, is a consequence of structural and functional alterations during oxidative stress
25918162 The internalization of apoD is mediated by basigin.
25513803 apoD mediates binding of high density lipoprotein to low density lipoprotein and to growing T24 carcinomas, thereby highlighting the importance of apoD in lipid metabolism.
25261976 The SNP rs7659 within the APOD gene might be related to risk and severity of ischemic stroke in patients.
24167586 We propose that strong brainstem expression of Apo D throughout adult life contributes to resistance against neurodegenerative disease and age-related degeneration, possibly by preventing oxidative stress and ensuing lipid peroxidation.
23895740 ApoD mRNA expression is seen in whole endometrium, stromal and epithelial cells in the secretory phase, as well as after hormonal stimulation in vitro.
23777559 Data suggest that ApoD binds various lyophilic ligands: retinoic acid, retinol, fatty acids, sphingomyelin, and anandamide. ApoD successfully delivers retinoic acid to immature neuronal cell line resulting in neurogenesis (i.e., neurite formation).
23715769 ApoE is located in the nucleus and on the ApoD promoter in human hepatic and glioblastoma cells lines.
23690001 Rs7659, 3' UTR polymorphism of the APOD gene was associated with early onset Alzheimer disease in APOEepsilon4 (-) subgroup. Our results suggest that the variation of the APOD gene modifies the risk for Alzheimer disease.
23296401 ApoD is marker of initial stages of colorectal cancer progression.
22479522 Molecular dynamics analysis of apolipoprotein-D-lipid hydroperoxide interactions show the mechanism for selective oxidation of Met-93
21705670 Endothelial cells downregulate apolipoprotein D expression in mural cells through paracrine secretion and Notch3 signaling.
21526344 increased JNK1 activation in the apocrine cells from axillary osmidrosis contributes to the increased ApoD expression
21429623 Our findings show that Apo D expression is influenced by age, Braak stage, and sex.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20493910 Importance of Parp-1, APEX-1 and ERK1/2 catalytic activities in the growth arrest-induced apoD gene expression.
20430392 Observational study of gene-disease association. (HuGE Navigator)
19944460 A strong relationship with gestational diabetes and APOD in the placenta that may reflect its suggested function in defense mechanisms against oxidative stress.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19723339 The decrease in plasma ApoD concentration during pregnancy is an adaptive response aimed at maintaining fetal lipid homeostasis.
19519777 apoD expression is increased throughout life in the human prefrontal cortex
19330472 Apolipoprotein D (APOD) and two further transcripts were significantly upregulated by dihydrotestosterone (DHT) in scrotum fibroblasts
19176353 Variations in the levels and/or sites of apoD expression influence the lipid and glucose metabolism, consolidating apoD as a target for insulin-resistance-related disorders.
18979643 study demonstrated that Apo D was highly expressed in the mRNA and protein levels in human failing hearts compared with non-failing hearts
18977241 Observational study of gene-disease association. (HuGE Navigator)
18842892 Role for apoD in regulation of inflammation. It may protect from HCoV-OC43-induced encephalitis, most likely through phospholipase A2 signaling pathways.
18671953 Logistic analysis revealed that both APOD rs5952 C and rs1568566 T alleles increase the risk of sporadic Alzheimer's disease. The rs5952T-rs1568566C haplotype showed lower risk.
18671953 Observational study of gene-disease association. (HuGE Navigator)
18458334 ApoD and its orthologs play an evolutionarily conserved role in response to stress, possibly managing or preventing lipid peroxidation.
18419796 These observations, together with its transcriptional up-regulation in the brain upon oxidative insult, identify ApoD as an acute response protein with a protective and therefore beneficial function mediated by the control of peroxidated lipids.
18330697 ApoD positive tumors had both a significantly shorter relapse-free survival (all locations) and a decreased breast cancer-specific survival.
17885669 Apo D differentiates superficial acral fibromyxoma from dermatofibrosarcoma protuberans.
17601350 Observational study of gene-disease association. (HuGE Navigator)
16966838 Observational study of gene-disease association. (HuGE Navigator)
16437381 study of the presence of apo D in the substantia nigra of control and Parkinson disease (PD) subjects; dopaminergic neurons were not immunoreactive for apo D but surrounding glial cells showed immunostaining for apo D and signal increases in PD cases
16402085 Observational study of gene-disease association. (HuGE Navigator)
15916898 Elevated apoD in AD brain may influence Abeta aggregation, or facilitate phagocytosis and transport of Abeta fibrils from plaques to cerebral vasculature.
15316799 Observational study of gene-disease association. (HuGE Navigator)
15316799 The -352G allele was associated with a significant 3-fold increase in the risk of early-onset Alzheimer's disease (OR: 2.7; 95% CI: 1.1-6.5). The -352G containing haplotypes were more common for early-onset Alzheimer's disease cases.
15192024 ApoD can be expressed or taken up by SMCs and can regulate their motility in response to growth factors.
14596852 In a study comparing brains from Alzheimer's patients and controls, it was found that hippocampal apolipoprotein D level depends on Braak stage and APOE genotype.
14551159 ApoD selectively modulates the proliferative response of vascular smooth muscle cells to growth factors by a mechanism related to nuclear translocation of ERK1/2.
12873803 Observational study of gene-disease association. (HuGE Navigator)
12873803 Apolipoprotein D levels are elevated in prefrontal cortex of subjects with Alzheimer's disease, suggesting that it may be related to the cognitive decline observed in AD patients.
12837283 APOD is a senescence-associated gene in normal human oral keratinocytes.
12497622 Observational study of gene-disease association. (HuGE Navigator)
12497622 Data suggest that the risk of Alzheimer disease among African-Americans may be modified by genetic variation in APOD.
12363390 Altered levels of apoD may help to understand the nature and possible mechanism of phospholipid membrane pathology in schizophrenia.
12052480 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME      1 - 70
NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL     71 - 140
FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS                         141 - 189
//

Text Mined References (86)

PMID Year Title
26829325 2016 Cerebral Apolipoprotein-D Is Hypoglycosylated Compared to Peripheral Tissues and Is Variably Expressed in Mouse and Human Brain Regions.
26083030 2015 Apolipoprotein D Transgenic Mice Develop Hepatic Steatosis through Activation of PPAR? and Fatty Acid Uptake.
25953740 2015 Apolipoprotein D subcellular distribution pattern in neuronal cells during oxidative stress.
25918162 2015 Apolipoprotein D Internalization Is a Basigin-dependent Mechanism.
25513803 2014 ApoD mediates binding of HDL to LDL and to growing T24 carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25261976 2014 Variations in apolipoprotein D and sigma non-opioid intracellular receptor 1 genes with relation to risk, severity and outcome of ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167586 2013 Lifelong expression of apolipoprotein D in the human brainstem: correlation with reduced age-related neurodegeneration.
23895740 2013 Cell-type specific expression and regulation of apolipoprotein D and E in human endometrium.
23777559 2013 Lipid-binding properties of human ApoD and Lazarillo-related lipocalins: functional implications for cell differentiation.
23715769 2013 Binding and repressive activities of apolipoprotein E3 and E4 isoforms on the human ApoD promoter.
23690001 2013 Genetic association between APOA1 and APOD polymorphisms and Alzheimer's disease in a Japanese population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23296401 2013 Expression and potential role of apolipoprotein D on the death-survival balance of human colorectal cancer cells under oxidative stress conditions.
22479522 2012 Molecular dynamics analysis of apolipoprotein-D-lipid hydroperoxide interactions: mechanism for selective oxidation of Met-93.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21705670 2011 Endothelial cells downregulate apolipoprotein D expression in mural cells through paracrine secretion and Notch signaling.
21526344 2011 Increased JNK1 activity contributes to the upregulation of ApoD in the apocrine secretory gland cells from axillary osmidrosis.
21429623 2012 Gender differences in apolipoprotein D expression during aging and in Alzheimer disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20493910 2010 Characterization of nuclear factors modulating the apolipoprotein D promoter during growth arrest: implication of PARP-1, APEX-1 and ERK1/2 catalytic activities.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20023409 2010 Apolipoprotein D: an overview of its role in aging and age-related diseases.
19944460 2010 Increase in placental apolipoprotein D as an adaptation to human gestational diabetes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19723339 2009 Modulation of Apolipoprotein D levels in human pregnancy and association with gestational weight gain.
19519777 2009 Apolipoprotein-D expression is increased during development and maturation of the human prefrontal cortex.
19330472 2009 Apolipoprotein D (APOD) is a putative biomarker of androgen receptor function in androgen insensitivity syndrome.
19176353 2009 Human apolipoprotein D overexpression in transgenic mice induces insulin resistance and alters lipid metabolism.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18979643 2008 Apolipoprotein D as a novel marker in human end-stage heart failure: a preliminary study.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18842892 2008 Neuroprotective effect of apolipoprotein D against human coronavirus OC43-induced encephalitis in mice.
18671953 2008 Association between polymorphisms in the apolipoprotein D gene and sporadic Alzheimer's disease.
18458334 2008 Human ApoD, an apolipoprotein up-regulated in neurodegenerative diseases, extends lifespan and increases stress resistance in Drosophila.
18419796 2008 Apolipoprotein D is involved in the mechanisms regulating protection from oxidative stress.
18330697 2009 Apolipoprotein D predicts adverse outcome in women >or=70 years with operable breast cancer.
17885669 2008 Apolipoprotein D in CD34-positive and CD34-negative cutaneous neoplasms: a useful marker in differentiating superficial acral fibromyxoma from dermatofibrosarcoma protuberans.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16966838 2006 Analysis of the association between Apolipoprotein D and schizophrenia.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16437381 2006 Apolipoprotein D expression in substantia nigra of Parkinson disease.
16402085 Apolipoprotein D is associated with long-term outcome in patients with schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15916898 2005 Apolipoprotein D is a component of compact but not diffuse amyloid-beta plaques in Alzheimer's disease temporal cortex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316799 2004 Genetic variation in apolipoprotein D and Alzheimer's disease.
15192024 2004 Apolipoprotein D and platelet-derived growth factor-BB synergism mediates vascular smooth muscle cell migration.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14596852 2003 Hippocampal apolipoprotein D level depends on Braak stage and APOE genotype.
14551159 2003 Apolipoprotein D inhibits platelet-derived growth factor-BB-induced vascular smooth muscle cell proliferated by preventing translocation of phosphorylated extracellular signal regulated kinase 1/2 to the nucleus.
14500696 2003 Apolipoprotein D expression in human brain reactive astrocytes.
12873803 2003 Apolipoprotein D levels are elevated in prefrontal cortex of subjects with Alzheimer's disease: no relation to apolipoprotein E expression or genotype.
12837283 2003 Senescence-associated genes in normal human oral keratinocytes.
12497622 2003 Genetic variation in apolipoprotein D affects the risk of Alzheimer disease in African-Americans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12363390 2002 Elevated plasma level of apolipoprotein D in schizophrenia and its treatment and outcome.
12052480 2002 Genetic variation in the apolipoprotein D gene among African blacks and its significance in lipid metabolism.
11744388 2002 Expression pattern of the lipocalin apolipoprotein D during mouse embryogenesis.
11344130 2001 Apolipoprotein D interacts with the long-form leptin receptor: a hypothalamic function in the control of energy homeostasis.
11058760 2000 Apolipoprotein D.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9278274 1997 Probing the structure of the ligand binding cavity of lipocalins by fluorescence spectroscopy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8692868 1996 A human axillary odorant is carried by apolipoprotein D.
8549691 1995 The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA, both species encoding members of the lipocalin superfamily.
7918467 1994 Structure of human apolipoprotein D: locations of the intermolecular and intramolecular disulfide links.
7613477 1995 Site-specific detection and structural characterization of the glycosylation of human plasma proteins lecithin:cholesterol acyltransferase and apolipoprotein D using HPLC/electrospray mass spectrometry and sequential glycosidase digestion.
6774335 1980 A cholesteryl ester transfer complex in human plasma.
3453108 1986 Cloning and expression of human apolipoprotein D cDNA.
2891117 1987 Multiple RFLPs at the human apolipoprotein D (APOD) locus.
2439269 1987 Human apolipoprotein D gene: gene sequence, chromosome localization, and homology to the alpha 2u-globulin superfamily.
2244881 1990 Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease.
2083249 1990 Is apolipoprotein D a mammalian bilin-binding protein?