Property Summary

NCBI Gene PubMed Count 34
PubMed Score 7.62
PubTator Score 9.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55056 B3KWY6 Q53YY8 Apo-CIV
Symbols APO-CIV
APOC-IV

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (19)

AA Sequence

MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQ      1 - 70
WFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG                  71 - 127
//

Text Mined References (36)

PMID Year Title