Property Summary

NCBI Gene PubMed Count 34
PubMed Score 7.03
PubTator Score 9.82

Knowledge Summary

Patent

No data available

Synonym

Accession P55056 B3KWY6 Q53YY8 Apo-CIV
Symbols APO-CIV
APOC-IV

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (19)

PMID Text
26129832 APOC4 rs1132899 polymorphism was associated with an increased risk of premature coronary artery disease in Chinese subjects.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
20972250 Observational study of gene-disease association. (HuGE Navigator)
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20498921 This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort.
20498921 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
18809223 ApoC-IV overexpression may perturb lipid metabolism leading to lipid accumulation. HCV core protein may modulate ApoC-IV expression through Ku antigen and PPARgamma/RXRalpha complex.
16763159 Observational study of gene-disease association. (HuGE Navigator)
12032151 regulated expression of gene cluster in macrophages
8530039 Includes the observation of APOC4-APOC2 read-through transcription

AA Sequence

MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQ      1 - 70
WFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG                  71 - 127
//

Text Mined References (36)

PMID Year Title
26129832 2015 The association of APOC4 polymorphisms with premature coronary artery disease in a Chinese Han population.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20498921 APOE/C1/C4/C2 gene cluster genotypes, haplotypes and lipid levels in prospective coronary heart disease risk among UK healthy men.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18809223 2008 Expression of apolipoprotein C-IV is regulated by Ku antigen/peroxisome proliferator-activated receptor gamma complex and correlates with liver steatosis.
18802019 2008 Common SNPs in HMGCR in micronesians and whites associated with LDL-cholesterol levels affect alternative splicing of exon13.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
17154273 2007 Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700345 2003 Human apoC-IV: isolation, characterization, and immunochemical quantification in plasma and plasma lipoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032151 2002 Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10996355 2000 DNA sequence variation in human apolipoprotein C4 gene and its effect on plasma lipid profile.
8910501 1996 In vivo footprinting analysis of the hepatic control region of the human apolipoprotein E/C-I/C-IV/C-II gene locus.
8827523 1996 Expression of a novel human apolipoprotein (apoC-IV) causes hypertriglyceridemia in transgenic mice.
8530039 1995 Identification and characterization of a new human gene (APOC4) in the apolipoprotein E, C-I, and C-II gene locus.