Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.53
PubTator Score 10.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.6e-07
osteosarcoma 7933 5.5e-05
Disease Target Count Z-score Confidence
Atherosclerosis 275 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.969 5.5e-05
lung adenocarcinoma -1.200 1.6e-07

Gene RIF (5)

PMID Text
23519644 The obesity risk alleles of non-synonymous SNPs at SH2B1 and APOB48R have no strong effect on weight loss-related phenotypes in overweight children after a 1-year lifestyle intervention.
22190030 These findings suggest that APOB48R represents a molecular target of postprandial lipoproteins via PPAR-dependent pathways in human monocytes and macrophages and advance an important link between postprandial metabolism of dietary fats and atherogenesis.
21367954 investigation of apoB48R gene transcription in circulating monocytes: increase in apoB48R gene transcription following high-fat meal
15830122 Nucleotide variations in the apolipoprotein B48 receptor gene is associated with hypercholesterolemia
15591219 Atherogenic remnant lipoproteins induced macrophage foam cell formation via apoB48R, indicating a potential role of apoB48R in atherosclerosis.

AA Sequence

MDFLRLYLPGLHQALRGALDSLGTFVSYLLGDAVPTVEREAQAAEELGVVAVGKTGKIVEEEAQEDLEGL      1 - 70
RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARK     71 - 140
KSKAGSGACQDRSGQAQERQESHEQEVNREERLRSWEQEEEEEEVRAREPGMARGAESEWTWHGETEGKA    141 - 210
GAVGPKAAGDNREMEQGVREADAGETEEPGAEGAGKGEEVVVVEKACESTRAWGTWGPGAEPEDWGILGR    211 - 280
EEARTTPGREEARAILDGEEARTISGGEEAETASGGEEAETASGGEEAGTASGGEEAGIASGGEAGTASG    281 - 350
GEEAGTASGGDEAWTTSGKEEADLLGVRQTEYGAVPGERLLEATGKVWVLEEEGDEEREAEVSPFPKQPQ    351 - 420
VLGTERTEEAAESQTAGREAVGGQEAGESFEGQVDLRGKEAEMRQDLGIRADRARMEELVQAEEAQEERG    421 - 490
SSRDPVAELPSDGEAEGTADLEATPEARPEEELTGEESEAAQTSCGLLGVEWGGLTHSVTKGQGPELMGG    491 - 560
AQTPTKQPEEREAGEVELMGVLALSKEEQERSLEAGPRHAGSVKPEASEAFPGAWENRTRKDMERGNTQE    561 - 630
DAADGEQREEEETAGGQTLAAEAEGDRESELSEVPEAGGEGLTTQDAGCGTEEGEASVSENQELDGSTGA    631 - 700
DAGPCPSLGEAYARETEDEEAEADRTSRRGWRLQAVAVGLPDREDAQTGSVAAGIMGGDVVPHISAAGAG    701 - 770
EALEGVLGQGWDSKEKEEAAAGEHAGGQEFGLEGSAEEEVTGRGSQVEAFESREGGPWGGRVEAEESAGA    771 - 840
EDSCGLDPAGSQTARAEGMGAMVEAGGLLEKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDA    841 - 910
EGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEAETAEAMGSARGGAANSWSEAPLP    911 - 980
GSLLDVSVPRSRVHLSRSSSQRRSRPSFRRTPAWEQQEEPPAPNPPEEELSAPEQRPLQLEEPLEPSPLR    981 - 1050
HDGTPVPARRRPLGHGFGLAHPGMMQELQARLGRPKPQ                                   1051 - 1088
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23519644 2013 Analyses of non-synonymous obesity risk alleles in SH2B1 (rs7498665) and APOB48R (rs180743) in obese children and adolescents undergoing a 1-year lifestyle intervention.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190030 2012 Triglyceride-rich lipoprotein regulates APOB48 receptor gene expression in human THP-1 monocytes and macrophages.
21367954 2011 A high-fat meal promotes lipid-load and apolipoprotein B-48 receptor transcriptional activity in circulating monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
15830122 2005 Association of nucleotide variations in the apolipoprotein B48 receptor gene (APOB48R) with hypercholesterolemia.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15591219 2005 Pitavastatin inhibits remnant lipoprotein-induced macrophage foam cell formation through ApoB48 receptor-dependent mechanism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700342 2003 PPAR(alpha) and PPAR(gamma) activators suppress the monocyte-macrophage apoB-48 receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10852956 2000 A macrophage receptor for apolipoprotein B48: cloning, expression, and atherosclerosis.
10191299 1999 Antipeptide antibodies reveal interrelationships of MBP 200 and MBP 235: unique apoB-specific receptors for triglyceride-rich lipoproteins on human monocyte-macrophages.
9633939 1998 Apolipoprotein B-48 or its apolipoprotein B-100 equivalent mediates the binding of triglyceride-rich lipoproteins to their unique human monocyte-macrophage receptor.
7619811 1995 Human THP-1 monocyte-macrophage membrane binding proteins: distinct receptor(s) for triglyceride-rich lipoproteins.