Property Summary

NCBI Gene PubMed Count 51
PubMed Score 44.39
PubTator Score 33.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 192 3.015 1.5

Expression

Gene RIF (70)

AA Sequence

MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDE      1 - 70
TQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPK     71 - 140
FADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV              141 - 200
//

Text Mined References (57)

PMID Year Title