Property Summary

NCBI Gene PubMed Count 183
PubMed Score 204.24
PubTator Score 380.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.557 1.0e-02
adult high grade glioma -1.200 3.4e-04

Gene RIF (146)

PMID Text
26556724 ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose.
26491253 Low levels of APOA1, APOC3, and APOA4 are associated with risk of Alzheimer disease.
26485402 the present findings reveal that High-altitude polycythemia -induced gastric mucosal lesion inspires the protection responses by up-regulating APOA4 and APOC3, and down-regulating GIF.
26397108 Single nucleotide polymorphisms (Rs7396835) of APOA4 protein did not increase the risk of CHD in the Chinese population.
25733664 the systematic conversion of conserved prolines to alanine increased the thermodynamic stability of apoA-IV and its propensity to oligomerize
25463085 analysis of methylation patterns of the APOA1/C3/A4/A5 cluster that may be directly involved in the transcriptional regulation of this cluster, especially in liver
24606699 Human papillomavirus E5 oncoproteins bind the A4 in endoplasmic reticulum to regulate proliferative ability upon differentiation.
24598141 transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH
24425874 The structure of human apolipoprotein A-IV as revealed by stable isotope-assisted cross-linking, molecular dynamics, and small angle x-ray scattering.
24311788 apoA-IV inhibits hepatic gluconeogenesis by decreasing Glc-6-Pase and PEPCK gene expression through NR1D1.
24211975 human apolipoproteina4 and apolipoproteinc3 genes are suppressed by phorbol myristate acetate in hepatic and intestinal cells
23338533 apoA-IV was increased in follicular fluid from polycystic ovary syndrome patients compared with those from normal controls
23288849 Small-angle X-ray scattering of apolipoprotein A-IV reveals the importance of its termini for structural stability
23132909 a novel function of apoA-IV in the biogenesis of discrete HDL-A-IV particles with the participation of ABCA1 and LCAT
23096082 APOA4 S347 allele predisposes to obesity and high waist circumference in Turkish postmenopausal women.
21767760 the ApoAI-CIII-AIV SacI polymorphism was associated with MI in Tunisian patients.
21712729 the APOA4 360His allele might be a risk factor for depression and unfavorable lipid profile and depression for elderly people in the Brazilian population
21407247 Significant decreases (at least P<0.05) were observed in sICAM concentrations in PON-1 55LM+MM, PON-1 QQ192 and APOA4-2 carriers while decreases in sVCAM in QR+RR and APOA4-1 carriers were observed.
21324458 APOA4 (rs675) was associated with triglyceride response in non-metabolic syndrome subjects.
21297956 increased CSF prothrombin, Apo A-IV, and haptoglobin may be involved in pathogenesis of HD and may serve as potential biomarkers for HD.
21127258 MTTP is regulated by apo A-IV in manner to promote increased packaging of triglyceride into chylomicron core, which may be important in neonatal fat absorption.
20810159 a candidate target molecule for the treatment of seasonal allergic rhinitis
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20674306 single nucleotide polymorphisms in apolipoproteins A-I, C3, A4, and A5, as modulated by dietary fat intake, appear to influence allostatic load parameters in Puerto Ricans
20674306 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20609189 serum apo A-IV level was independently associated with creatinine, the neutrophil/ lymphocyte ratio, and maximum carotid intima media thickness; Serum apo A-IV is associated with atherosclerotic lesions in hemodialysis patients
20602615 Observational study of gene-disease association. (HuGE Navigator)
20554794 Data establish that the T347S substitution alters the conformation of apolipoprotein A-IV and lowers its interfacial activity-changes that could account for the effect of this polymorphism on postprandial lipid metabolism.
20430392 Observational study of gene-disease association. (HuGE Navigator)
20164363 This study supports the concept that single nucleotide polymorphisms in APOA1and APOA4 genes influences atherogenic characteristics of low density lipoprotein particles in response to diet.
20164363 Clinical trial of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20117098 The two common aminoacid substitutions,T347S and Q360H , have no effect on the ability of apoA-IV to maintain endothelial homeostasis.
20031551 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19732897 polymorphisms in the apolipoprotein A1/C3/A4/A5 gene cluster may have roles in familial combined hyperlipidaemia in Hong Kong Chinese
19732897 Observational study of gene-disease association. (HuGE Navigator)
19701693 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19689828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19592705 We have identified new associations between SNPs in the APOA1/C3/A4/A5 gene cluster and altered postprandial lipid metabolism.
19592705 Observational study of gene-disease association. (HuGE Navigator)
19433068 results indicate that human apoA-IV is regulated directly by PPARalphavia the -2979/-2967 PPRE
19403283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336561 Reduced apolipoprotein A-IV expression is associated with ovarian cancer.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19057464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18948973 Blood levels increase after gastric bypass in morbid obesity, which may contribute to weight loss as well as the improvements in inflammation and cardiovascular disease.
18789138 Observational study of gene-disease association. (HuGE Navigator)
18678879 the apoCIII enhancer contributes to the maintenance of an active chromatin subdomain of the apoAI/CIII/AIV genes, but not apoAV
18676680 Observational study of gene-disease association. (HuGE Navigator)
18664021 Codon 9, Msp I and VNTR polymorphisms in the apo A-IV gene are associated with type-IV hyperlipoproteinaemia in a Chinese population.
18664021 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18430727 lipid-free apoA-IV exists as a complex helical bundle with the N and C termini in close proximity
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17964293 Observational study of gene-disease association. (HuGE Navigator)
17855807 Observational study of gene-disease association. (HuGE Navigator)
17825930 genetic variation of 3' flanking region of ApoA-I (PstI), 3' untranslated region of ApoC-III (SstI) and intron 2 of ApoA-IV (XbaI) in 193 angiographically diagnosed coronary heart disease Punjab patients
17825930 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17712726 ApoA-IV expression is significantly impaired in inflammatory bowel diseases mucosa, even in non-inflamed regions.
17654446 Polymorphisms in ApoAI-CIII-AIV gene cluster are associated with risks of diabetes and coronary heart disease.
17457002 Observational study of gene-disease association. (HuGE Navigator)
17378725 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17378725 Variants may play an important role in the individual sensitivity of lipid parameters to dietary composition in men.
17261136 Observational study of gene-disease association. (HuGE Navigator)
17206692 ApoA-IV polymorphism is not associated with either disease activity or apoA-IV plasma levels in patients with Crohn's disease or ulcerative colitis.
17130180 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16945374 apoA-IV can bind to LDL & acts as a site-specific antioxidant. reduced inhibition of LDL oxidation by apoA-IV-S347 compared to wild type apoA-IV may account for previous association of the APOA4 S347 variant with increased CHD risk & oxidative stress.
16929032 the induction of apoA-IV expression in fasting and diabetes likely involves PGC-1 alpha-mediated coactivation of HNF-4 alpha in addition to glucocorticoid-dependent actions
16788210 Data demonstrate that the increase of apoA-IV caused by renal impairment is significantly modulated by low levels of serum albumin as a measure for the severity of the nephrotic syndrome.
16781717 Observational study of gene-disease association. (HuGE Navigator)
16781717 the variability in APOA1/C3/A4/A5 gene cluster may affect TG and HDL levels in women with type 2 diabetes
16770585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16770585 Potential interactions between APOA4 genotypes and metabolic/oxidative stress components of the diabetic milieu leading to rapid progression of atherosclerosis.
16763159 Observational study of gene-disease association. (HuGE Navigator)
16710093 Observational study of gene-disease association. (HuGE Navigator)
16651467 Observational study of gene-disease association. (HuGE Navigator)
16602826 Because modulation of lipoproteins is also seen in genetically altered longevity models, it may be a common pathway influencing lifespan from nematodes to humans
16338932 E-cadherin controls enterocyte-specific expression of genes, such as the apoA-IV gene, through the control of hepatic nuclear factor 4alpha nuclear abundance
16326171 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16326171 While female carriers of the APOA4(347) S allele had lower TG concentrations than those with the common T/T allele, males with the S allele had higher concentrations.
16321685 Observational study of gene-disease association. (HuGE Navigator)
16159879 the C-terminal sequence can modulate the conformation and lipid affinity of apoA-IV
16120654 novel role for Apo A-IV in the regulation of intracellular glutathione redox balance and the modulation of redox-dependent apoptosis via stimulation of G6PD activity
16105043 ApoA-IV immunostaining was detected in proximal and distal tubular cells, capillaries and blood vessels but not inside glomeruli
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15962178 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15928313 HNF-4alpha and gamma functionally interact with a second hormone-responsive element present in the proximal region of the human apoA-IV promoter.
15910632 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15868628 Observational study of gene-environment interaction. (HuGE Navigator)
15864114 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15823278 Observational study of gene-disease association. (HuGE Navigator)
15806598 Observational study of gene-disease association. (HuGE Navigator)
15806598 A significant association between the presence of apolipoprotein A-IV His allele and cerebrovascular disease, obesity and depression.
15764642 Observational study of gene-disease association. (HuGE Navigator)
15721024 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15721024 the apo A-IV-2 allele is associated with a modest reduction in plasma triglyceride levels in the general population
15649902 the apoCIII enhancer regulates expression of apoAI, apo-CIII, and apoAIV but not apoAV in vivo; the entire cluster has roles in regulating lipid metabolism
15559160 Observational study of genotype prevalence. (HuGE Navigator)
15488874 Observational study of gene-disease association. (HuGE Navigator)
15359534 Observational study of gene-disease association. (HuGE Navigator)
15311933 the amphipathic alpha helices in apoA4 form a large domain that may be similar to the N-terminal helical bundle domains of apoA1 and apoE but apoA4 lacks the C-terminal lipid-binding and cholesterol efflux-promoting domain of these apolipoproteins
15304365 Human apoA-I/C-III/A-IV transgenic rabbits may provide a reliable model for studies of the transcriptional regulation of the cluster, and for evaluating the effects of different agents on the expression of the three genes.
15258202 apoA-IV may physically interact with apoB in the secretory pathway and affects intracellular distribution of apoB
15254593 Results provide the first direct support for the hypothesis that apolipoprotein A-IV is an endogenous anti-inflammatory protein.
15252864 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15175360 Observational study of gene-disease association. (HuGE Navigator)
14751811 H-apoA-IV expression in apoE(0) mice reduces atherogenesis & decreases proinflammatory cytokine secretion after LPS administration. h-apoA-IV exerts its protective role by specifically, but partially, inhibiting LPS-induced stimulation of monocytes.
12962772 Observational study of gene-disease association. (HuGE Navigator)
12860258 Observational study of gene-disease association. (HuGE Navigator)
12777472 No major differences exist in the apoA-IV plasma distribution pattern between coronary artery disease patients and controls; therefore, the antiatherogenic effect of apoA-IV has to be explained by other functional properties of apoA-IV
12697303 Observational study of gene-disease association. (HuGE Navigator)
12691171 Clinical trial of gene-environment interaction. (HuGE Navigator)
12676816 Observational study of gene-disease association. (HuGE Navigator)
12676816 Apolipoprotein AIV gene variant S347 is associated with increased risk of coronary heart disease and lower plasma apolipoprotein AIV levels.
12664082 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12556235 Observational study of gene-disease association. (HuGE Navigator)
12495081 Observational study of genotype prevalence. (HuGE Navigator)
12417525 Observational study of gene-disease association. (HuGE Navigator)
12417525 Association between APOA4 and triglycerides (TG) reflects linkage disequilibrium with known TG-raising sites.
12220435 Observational study of gene-disease association. (HuGE Navigator)
12121350 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12121350 Association of apolipoprotein A-IV genotype with blood glucose, plasma lipoprotein levels, total cholesterol, and triglycerides in a gender-specific manner
12116231 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11952809 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11941585 Observational study of gene-disease association. (HuGE Navigator)
11940599 Interfacial exclusion pressure determines the ability of apolipoprotein A-IV truncation mutants to activate cholesterol ester transfer protein
11841825 Effect of human Apo AIV against lipid peroxidation of very low density lipoproteins
11592042 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11583715 Observational study of gene-disease association. (HuGE Navigator)
11472750 Observational study of gene-disease association. (HuGE Navigator)
11181750 Observational study of gene-disease association. (HuGE Navigator)
11108737 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVN      1 - 70
TYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYAD     71 - 140
QLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKV    141 - 210
KIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG    211 - 280
NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDK    281 - 350
VNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES                            351 - 396
//

Text Mined References (187)

PMID Year Title
26556724 2015 Interaction of ApoA-IV with NR4A1 and NR1D1 Represses G6Pase and PEPCK Transcription: Nuclear Receptor-Mediated Downregulation of Hepatic Gluconeogenesis in Mice and a Human Hepatocyte Cell Line.
26491253 2015 Decreased expression of the APOA1-APOC3-APOA4 gene cluster is associated with risk of Alzheimer's disease.
26485402 2015 Transcriptome Reveals 1400-Fold Upregulation of APOA4-APOC3 and 1100-Fold Downregulation of GIF in the Patients with Polycythemia-Induced Gastric Injury.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
25733664 2015 Role of Conserved Proline Residues in Human Apolipoprotein A-IV Structure and Function.
25463085 2014 Tissue-specific DNA methylation profiles regulate liver-specific expression of the APOA1/C3/A4/A5 cluster and can be manipulated with demethylating agents on intestinal cells.
24606699 2014 Human papillomavirus E5 oncoproteins bind the A4 endoplasmic reticulum protein to regulate proliferative ability upon differentiation.
24598141 2014 Transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH.
24425874 2014 The structure of human apolipoprotein A-IV as revealed by stable isotope-assisted cross-linking, molecular dynamics, and small angle x-ray scattering.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24311788 2014 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211975 2014 Transcriptional suppression of human apolipoproteinA4 and apolipoproteinC3 genes by phorbol myristate acetate in hepatic and intestinal cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23338533 2013 Apolipoprotein A-IV as a novel gene associated with polycystic ovary syndrome.
23288849 2013 Small-angle X-ray scattering of apolipoprotein A-IV reveals the importance of its termini for structural stability.
23132909 2013 ApoA-IV promotes the biogenesis of apoA-IV-containing HDL particles with the participation of ABCA1 and LCAT.
23096082 2012 Minor allele of the APOA4 gene T347S polymorphism predisposes to obesity in postmenopausal Turkish women.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22579246 2012 The structure of dimeric apolipoprotein A-IV and its mechanism of self-association.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21767760 2011 Association of a DNA polymorphism of the apolipoprotein AI-CIII-AIV gene cluster with myocardial infarction in a Tunisian population.
21712729 2011 APOA4 polymorphism as a risk factor for unfavorable lipid serum profile and depression: a cross-sectional study.
21407247 2011 Effect of walnut-enriched meat on the relationship between VCAM, ICAM, and LTB4 levels and PON-1 activity in ApoA4 360 and PON-1 allele carriers at increased cardiovascular risk.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21324458 2011 Association of gene variants with lipid levels in response to fenofibrate is influenced by metabolic syndrome status.
21297956 2011 Increased prothrombin, apolipoprotein A-IV, and haptoglobin in the cerebrospinal fluid of patients with Huntington's disease.
21269460 2011 Initial characterization of the human central proteome.
21127258 2011 Regulation of microsomal triglyceride transfer protein by apolipoprotein A-IV in newborn swine intestinal epithelial cells.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20810159 2010 Apolipoprotein A-IV is a candidate target molecule for the treatment of seasonal allergic rhinitis.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20674306 2011 The APOA1/C3/A4/A5 cluster and markers of allostatic load in the Boston Puerto Rican Health Study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20609189 2010 Impact of serum apolipoprotein A-IV as a marker of cardiovascular disease in maintenance hemodialysis patients.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20554794 2010 Distinctive structure and interfacial activity of the human apolipoprotein A-IV 347S isoprotein.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20164363 2010 APOA1 and APOA4 gene polymorphisms influence the effects of dietary fat on LDL particle size and oxidation in healthy young adults.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20117098 2010 Structure and function of the apoA-IV T347S and Q360H common variants.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19732897 2010 Associations of polymorphisms in the apolipoprotein A1/C3/A4/A5 gene cluster with familial combined hyperlipidaemia in Hong Kong Chinese.
19701693 2010 Genetic variants on apolipoprotein gene cluster influence triglycerides with a risk of coronary artery disease among Indians.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19689828 2009 Nutrigenetics: links between genetic background and response to Mediterranean-type diets.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19592705 2010 Effects of variations in the APOA1/C3/A4/A5 gene cluster on different parameters of postprandial lipid metabolism in healthy young men.
19433068 2009 Identification of a functional peroxisome proliferator-activated receptor (PPAR) response element (PPRE) in the human apolipoprotein A-IV gene.
19403283 2010 APOE, CETP and LPL genes show strong association with lipid levels in Greek children.
19336561 2009 Afamin and apolipoprotein A-IV: novel protein markers for ovarian cancer.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19074352 2008 A null mutation in human APOC3 confers a favorable plasma lipid profile and apparent cardioprotection.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19057464 2009 Pharmacogenetic association of the APOA1/C3/A4/A5 gene cluster and lipid responses to fenofibrate: the genetics of lipid-lowering drugs and diet network study.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18948973 2009 Apolipoprotein A-IV, a putative satiety/antiatherogenic factor, rises after gastric bypass.
18789138 2008 The APOA5 Trp19 allele is associated with metabolic syndrome via its association with plasma triglycerides.
18678879 2008 The apolipoprotein CIII enhancer regulates both extensive histone modification and intergenic transcription of human apolipoprotein AI/CIII/AIV genes but not apolipoprotein AV.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18664021 2008 Distribution and effect of apo A-IV genotype on plasma lipid and apolipoprotein levels in a Chinese population.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18430727 2008 A three-dimensional homology model of lipid-free apolipoprotein A-IV using cross-linking and mass spectrometry.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17964293 2008 Genetic association study of APOA1/C3/A4/A5 gene cluster and haplotypes on triglyceride and HDL cholesterol in a community-based population.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17825930 2008 A novel haplotype in ApoAI-CIII-AIV gene region is detrimental to Northwest Indians with coronary heart disease.
17712726 2007 The satiety factor apolipoprotein A-IV modulates intestinal epithelial permeability through its interaction with alpha-catenin: implications for inflammatory bowel diseases.
17654446 2007 The ApoAI-CIII-AIV gene cluster and its relation to lipid levels in type 2 diabetes mellitus and coronary heart disease: determination of a novel susceptible haplotype.
17457002 2007 Apolipoprotein A-I/C-III/A-IV SstI and apolipoprotein B XbaI polymorphisms do not affect early functional and structural changes in atherosclerosis: the Cardiovascular Risk in Young Finns study.
17378725 2007 Polymorphisms in the APOA1/C3/A4/A5 gene cluster and cholesterol responsiveness to dietary change.
17261136 2007 Apolipoprotein AI-CIII-AIV gene cluster polymorphisms in relation to cholesterol gallstone.
17206692 2007 Apolipoprotein A-IV is an independent predictor of disease activity in patients with inflammatory bowel disease.
17154273 2007 Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF.
17130180 2007 Candidate gene genotypes, along with conventional risk factor assessment, improve estimation of coronary heart disease risk in healthy UK men.
16945374 2007 Common variants of apolipoprotein A-IV differ in their ability to inhibit low density lipoprotein oxidation.
16929032 2006 Apolipoprotein A-IV is regulated by nutritional and metabolic stress: involvement of glucocorticoids, HNF-4 alpha, and PGC-1 alpha.
16788210 2006 Role of the kidney in the metabolism of apolipoprotein A-IV: influence of the type of proteinuria.
16781717 2007 Associations of the apolipoprotein A1/C3/A4/A5 gene cluster with triglyceride and HDL cholesterol levels in women with type 2 diabetes.
16770585 2006 The apolipoprotein A-IV Gln360His polymorphism predicts progression of coronary artery calcification in patients with type 1 diabetes.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16710093 2006 Evidence for consistent intragenic and intergenic interactions between SNP effects in the APOA1/C3/A4/A5 gene cluster.
16651467 2006 Polymorphism in the beta2-adrenergic receptor and lipoprotein lipase genes as risk determinants for idiopathic venous thromboembolism: a multilocus, population-based, prospective genetic analysis.
16602826 2006 Lipoprotein genotype and conserved pathway for exceptional longevity in humans.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16338932 2006 E-cadherin-dependent transcriptional control of apolipoprotein A-IV gene expression in intestinal epithelial cells: a role for the hepatic nuclear factor 4.
16326171 2006 Associations between plasma lipid parameters and APOC3 and APOA4 genotypes in a healthy population are independent of dietary cholesterol intake.
16321685 2006 Impact of APOA5/A4/C3 genetic polymorphisms on lipid variables and cardiovascular disease risk in French men.
16159879 2005 Specific sequences in the N and C termini of apolipoprotein A-IV modulate its conformation and lipid association.
16120654 2006 Apolipoprotein A-IV attenuates oxidant-induced apoptosis in mitotic competent, undifferentiated cells by modulating intracellular glutathione redox balance.
16105043 2005 Immunohistochemical localization of apolipoprotein A-IV in human kidney tissue.
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
15962178 2005 APOA1/C3/A4 gene cluster variability and lipid levels in Brazilian children.
15928313 2005 Intestinal apolipoprotein A-IV gene transcription is controlled by two hormone-responsive elements: a role for hepatic nuclear factor-4 isoforms.
15910632 2005 Association between MspI polymorphism of the APO AI gene and Type 2 diabetes mellitus.
15868628 2005 Response to a urate-lowering diet according to polymorphisms in the apolipoprotein AI-CIII-AIV cluster.
15864114 2005 Genetic and environmental factors affecting the response to statin therapy in patients with molecularly defined familial hypercholesterolaemia.
15823278 2005 Apolipoprotein A-I/C-III/A-IV SstI and apolipoprotein B XbaI polymorphisms and their association with carotid artery intima-media thickness in the Finnish population. The Cardiovascular Risk in Young Finns Study.
15806598 2005 Association of the apolipoprotein A-IV: 360 Gln/His polymorphism with cerebrovascular disease, obesity, and depression in a Brazilian elderly population.
15764642 2005 Additive effects of the PPARgamma, APOE, and FABP-2 genes in increasing daylong triglycerides of normolipidemic women to concentrations comparable to those in men.
15721024 2005 Association of apo A-IV 360 (Gln --> His) polymorphism with plasma lipids and lipoproteins: the Framingham Offspring Study.
15649902 2005 The expression of intact and mutant human apoAI/CIII/AIV/AV gene cluster in transgenic mice.
15559160 2004 Apolipoprotein E and A-IV polymorphisms in ethnic Russians living in Estonia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488874 2004 A prospective study of the APOA1 XmnI and APOC3 SstI polymorphisms in the APOA1/C3/A4 gene cluster and risk of incident myocardial infarction in men.
15359534 2004 Frequencies of apolipoprotein A4 gene polymorphisms and association with serum lipid concentrations in two healthy Spanish populations.
15311933 2004 Structure of human apolipoprotein A-IV: a distinct domain architecture among exchangeable apolipoproteins with potential functional implications.
15304365 2004 Human apoA-I/C-III/A-IV gene cluster transgenic rabbits: effects of a high-cholesterol diet.
15258202 2004 apoA-IV tagged with the ER retention signal KDEL perturbs the intracellular trafficking and secretion of apoB.
15254593 2004 Apolipoprotein A-IV inhibits experimental colitis.
15252864 2004 Population genetics of apolipoproteins A-IV, E, and H, and the angiotensin converting enzyme (ACE): associations with lipids, and apolipoprotein levels in American Samoans.
15175360 2004 The APOA4 T347S variant is associated with reduced plasma TAOS in subjects with diabetes mellitus and cardiovascular disease.
15108119 2004 The effects of scale: variation in the APOA1/C3/A4/A5 gene cluster.
14751811 2004 Human apolipoprotein A-IV reduces secretion of proinflammatory cytokines and atherosclerotic effects of a chronic infection mimicked by lipopolysaccharide.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12962772 2003 Effect of apolipoprotein polymorphisms in renal transplant recipients.
12860258 2003 Analysis of the apo(a) size polymorphism in Asian Indian populations: association with Lp(a) concentration and coronary heart disease.
12777472 2003 Plasma distribution of apoA-IV in patients with coronary artery disease and healthy controls.
12697303 2003 Contribution of APOA5 gene variants to plasma triglyceride determination and to the response to both fat and glucose tolerance challenges.
12692552 2003 Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.
12691171 2002 Genetic polymorphisms and lipoprotein responses to diets.
12676816 2003 Apolipoprotein AIV gene variant S347 is associated with increased risk of coronary heart disease and lower plasma apolipoprotein AIV levels.
12664082 2003 Further evidence for the association between obesity-related traits and the apolipoprotein A-IV gene.
12556235 2003 The study of APOA1, APOC3 and APOA4 variability in healthy ageing people reveals another paradox in the oldest old subjects.
12495081 2002 Genetic variation of apolipoproteins in North Indians.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417525 2002 Relative contribution of variation within the APOC3/A4/A5 gene cluster in determining plasma triglycerides.
12220435 2002 Genetic polymorphisms of the apolipoprotein A-IV in a Greek population and their relation to plasma lipid and lipoprotein levels.
12121350 2002 Effects of apolipoprotein A-IV genotype on glucose and plasma lipoprotein levels.
12116231 2002 Candidate genes involved in cardiovascular risk factors by a family-based association study on the island of Kosrae, Federated States of Micronesia.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
11952809 2002 Relationship of genetic variation in genes encoding apolipoprotein A-IV, scavenger receptor BI, HMG-CoA reductase, CETP and apolipoprotein E with cholesterol metabolism and the response to plant stanol ester consumption.
11941585 2002 [Variations of apolipoprotein A IV gene in Chinese endogenous hypertriglyceridemics].
11841825 2002 Effect of human Apo AIV against lipid peroxidation of very low density lipoproteins.
11592042 2001 [Analysis of apoA IV gene VNTR polymorphism in Chinese endogenous hypertriglyceridemics].
11583715 2001 Two polymorphisms in the apo A-IV gene and familial combined hyperlipidemia.
11472750 2001 Excess coronary heart disease in Familial Combined Hyperlipidemia, in relation to genetic factors and central obesity.
11254757 2001 GPI-specific phospholipase D associates with an apoA-I- and apoA-IV-containing complex.
11181750 2001 Effect of the apolipoprotein A-IV Q360H polymorphism on postprandial plasma triglyceride clearance.
11162594 2001 Apolipoprotein specificity for lipid efflux by the human ABCAI transporter.
11108737 2000 Effect of apolipoprotein A-IV genotype and dietary fat on cholesterol absorption in humans.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
10069372 1999 Regulation of the human apolipoprotein AIV gene expression in transgenic mice.
9988739 1999 The -700/-310 fragment of the apolipoprotein A-IV gene combined with the -890/-500 apolipoprotein C-III enhancer is sufficient to direct a pattern of gene expression similar to that for the endogenous apolipoprotein A-IV gene.
8956036 1996 Two novel apolipoprotein A-IV variants in individuals with familial combined hyperlipidemia and diminished levels of lipoprotein lipase activity.
8688083 1996 Protection against atherogenesis in mice mediated by human apolipoprotein A-IV.
7728150 1995 Apolipoprotein A-IV polymorphism in the Hungarian population: gene frequencies, effect on lipid levels, and sequence of two new variants.
6706947 1984 Biosynthesis of human preapolipoprotein A-IV.
4345202 1973 Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.
3931073 1985 Apolipoprotein multigene family: tandem organization of human apolipoprotein AI, CIII, and AIV genes.
3755616 1986 Structure, evolution, and tissue-specific synthesis of human apolipoprotein AIV.
3611972 1987 Effect of lecithin:cholesterol acyltransferase on distribution of apolipoprotein A-IV among lipoproteins of human plasma.
3095836 1986 Structure, evolution, and polymorphisms of the human apolipoprotein A4 gene (APOA4).
3095477 1986 Plasma metabolism of apolipoprotein A-IV in humans.
3080432 1986 The nucleotide and derived amino acid sequence of human apolipoprotein A-IV mRNA and the close linkage of its gene to the genes of apolipoproteins A-I and C-III.
3036793 1987 Structure and expression of the human apolipoprotein A-IV gene.
2930771 1989 The primary structure of human apolipoprotein A-IV.
2351649 1990 Genetic polymorphism of human plasma apolipoprotein A-IV is due to nucleotide substitutions in the apolipoprotein A-IV gene.
2331673 1990 Physical mapping of the human chromosome 11q23 region containing the ataxia-telangiectasia locus.
2307668 1990 Lipoprotein ApoC-II activation of lipoprotein lipase. Modulation by apolipoprotein A-IV.
2216752 1990 Study of the sequence tagged site (STS) in the beginning of human apo A4 gene region.
2065039 The mutation causing the common apolipoprotein A-IV polymorphism is a glutamine to histidine substitution of amino acid 360.
1973689 1990 Human plasma apolipoproteins A-IV-0 and A-IV-3. Molecular basis for two rare variants of apolipoprotein A-IV-1.
1935934 1991 Functional characterization of human recombinant apolipoprotein AIV produced in Escherichia coli.
1737067 1992 A novel polymorphism of apolipoprotein A-IV is the result of an asparagine to serine substitution at residue 127.
1677358 1991 Three genetic variants of human plasma apolipoprotein A-IV. apoA-IV-1(Thr347----Ser), apoA-IV-0(Lys167----Glu,Gln360----His), and apoA-IV-3(Glu165----Lys).
1487136 1992 Molecular basis of a unique African variant (A-IV 5) of human apolipoprotein A-IV and its significance in lipid metabolism.
1349197 1992 Nonsynonymous polymorphic sites in the apolipoprotein (apo) A-IV gene are associated with changes in the concentration of apo B- and apo A-I-containing lipoproteins in a normal population.