Property Summary

NCBI Gene PubMed Count 33
PubMed Score 23.47
PubTator Score 42.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.3e-05
tuberculosis and treatment for 6 months 686 1.3e-04
psoriasis 6685 1.6e-04
lung cancer 4473 1.9e-04
osteosarcoma 7933 4.2e-04

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 1.6e-04
osteosarcoma -1.108 4.2e-04
tuberculosis and treatment for 6 months 1.200 1.3e-04
lung cancer 1.700 1.9e-04
ovarian cancer 1.900 2.3e-05

Gene RIF (15)

PMID Text
26673663 Authors propose a proapoptotic role for NP in IAV pathogenesis, whereby it suppresses expression of antiapoptotic factor API5, thus potentiating the E2F1-dependent apoptotic pathway and ensuring viral replication.
25819896 rs17684886 (ZNRF1) and rs599019 (COLEC12) are associated with diabetic retinopathy and rs6427247 (SCYL1BP1) and rs899036 (API5) are associated with severe diabetic retinopathy in Chinese patients with type 2 diabetes
25477374 miR-143 and miR-145 and the predicted target proteins API5, ERK5, K-RAS, and IRS-1 display regional differences in expression in the colon
25433291 Negative regulation of API-5 expression by miR-1 was demonstrated to promote apoptosis of HepG2 cells.
25248562 Authors show that API5 increases the metastatic capacity of cervical cancer cells in vitro and in vivo via up-regulation of MMP-9.
25070070 API5 overexpression promoted cell proliferation and colony formation in CaSki cancer cells, whereas API5 knockdown inhibited the both properties in HeLa cells; API5 expression is associated with pERK1/2 in a subset of cervical cancer patients and its expression predicts poor overall survival.
24785373 Low miR-224 and high API5 expression correlated with worse survival of glioblastoma patients.
24769442 API5 acts as an immune escape gene in tumors by rendering them resistant to apoptosis triggered by tumor antigen-specific T cells.
23940755 Api5, even if not physically interacting with E2F1, contributes positively to E2F1 transcriptional activity by increasing E2F1 binding to its target promoters.
22334682 structure and function of API5
20671611 The prognostic significance of the genes casein kinase 2 alpha subunit (CSNK2A1), anti-apoptosis clone-11 (AAC-11), and tumor metastasis suppressor NME1 in completely resected non-small cell lung cancer (NSCLC) patients, was analysed.
19821157 we infer that Pim-2 could activate API-5 to inhibit the apoptosis of liver cells, and NF-kappaB is the key regulator
19387494 The authors report here that AAC-11, a survival protein whose expression prevents apoptosis that occurs on deprivation of growth factors, physiologically binds to Acinus and prevents Acinus-mediated DNA fragmentation.
18319255 define a true in vivo target of miR-224 and reaffirm the important role of miRNAs in the dysregulation of cellular processes that may ultimately lead to tumorigenesis
17112319 Apoptosis inhibitor-5/antiapoptosis clone-11 (Api5/Aac11) is a critical determinant of dE2F1-induced apoptosis in vivo and in vitro.

AA Sequence

MPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDL      1 - 70
CEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQI     71 - 140
LQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGR    141 - 210
QQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGL    211 - 280
DIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSF    281 - 350
HQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNN    351 - 420
INVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSS    421 - 490
NLGNFNYEQRGAFRGSRGGRGWGTRGNRSRGRLY                                        491 - 524
//

Text Mined References (44)

PMID Year Title
26673663 2015 Nucleoprotein of influenza A virus negatively impacts antiapoptotic protein API5 to enhance E2F1-dependent apoptosis and virus replication.
25819896 2015 Common variants in or near ZNRF1, COLEC12, SCYL1BP1 and API5 are associated with diabetic retinopathy in Chinese patients with type 2 diabetes.
25477374 2015 Tumor suppressors miR-143 and miR-145 and predicted target proteins API5, ERK5, K-RAS, and IRS-1 are differentially expressed in proximal and distal colon.
25433291 2015 MicroRNA-1 promotes apoptosis of hepatocarcinoma cells by targeting apoptosis inhibitor-5 (API-5).
25248562 2015 Apoptosis Inhibitor 5 Increases Metastasis via Erk-mediated MMP expression.
25070070 2014 Apoptosis inhibitor-5 overexpression is associated with tumor progression and poor prognosis in patients with cervical cancer.
24785373 2014 MiR-224 expression increases radiation sensitivity of glioblastoma cells.
24769442 2014 API5 confers tumoral immune escape through FGF2-dependent cell survival pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23940755 2013 Api5 contributes to E2F1 control of the G1/S cell cycle phase transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22334682 2012 Helical repeat structure of apoptosis inhibitor 5 reveals protein-protein interaction modules.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20671611 2010 Gene expression levels of CSNK1A1 and AAC-11, but not NME1, in tumor tissues as prognostic factors in NSCLC patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19821157 2010 Pim-2 activates API-5 to inhibit the apoptosis of hepatocellular carcinoma cells through NF-kappaB pathway.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19387494 2009 The antiapoptotic protein AAC-11 interacts with and regulates Acinus-mediated DNA fragmentation.
18319255 2008 Profiling microRNA expression in hepatocellular carcinoma reveals microRNA-224 up-regulation and apoptosis inhibitor-5 as a microRNA-224-specific target.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17827341 2007 The antiapoptotic protein Api5 and its partner, high molecular weight FGF2, are up-regulated in B cell chronic lymphoid leukemia.
17112319 2006 Functional identification of Api5 as a suppressor of E2F-dependent apoptosis in vivo.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12703993 2003 [Effect of beta-carotene on gene expression of breast cancer cells].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11557113 2001 Expression of the antiapoptosis gene, AAC-11, as a prognosis marker in non-small cell lung cancer.
11555636 2001 Large-scale identification of mammalian proteins localized to nuclear sub-compartments.
11075807 2000 FIF [fibroblast growth factor-2 (FGF-2)-interacting-factor], a nuclear putatively antiapoptotic factor, interacts specifically with FGF-2.
10780674 2000 AAC-11 overexpression induces invasion and protects cervical cancer cells from apoptosis.
10393420 1999 Molecular cloning and fine mapping of API5L1, a novel human gene strongly related to an antiapoptotic gene.
9307294 1997 AAC-11, a novel cDNA that inhibits apoptosis after growth factor withdrawal.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.