Property Summary

NCBI Gene PubMed Count 54
PubMed Score 70.74
PubTator Score 77.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.8e-04
atypical teratoid / rhabdoid tumor 1.300 5.8e-04
COPD -1.200 1.4e-03
ependymoma 1.400 1.0e-08
glioblastoma 1.100 8.2e-05
group 3 medulloblastoma 1.400 1.2e-02
invasive ductal carcinoma 1.100 4.6e-03
medulloblastoma, large-cell 1.200 3.6e-05
osteosarcoma 2.382 1.8e-05
ovarian cancer 1.300 9.3e-09
pediatric high grade glioma 1.400 1.6e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (31)

AA Sequence

MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYG      1 - 70
LLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILAD     71 - 140
ALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWY    141 - 210
EASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED                   211 - 265
//

Text Mined References (56)

PMID Year Title